Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   RF668_RS04185 Genome accession   NZ_CP133787
Coordinates   827340..827639 (+) Length   99 a.a.
NCBI ID   WP_021037947.1    Uniprot ID   A0AAX4AJK4
Organism   Lactococcus cremoris strain KCKM 0438     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 822340..832639
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RF668_RS04155 (RF668_04155) comGA 823949..824929 (+) 981 WP_043736167.1 competence type IV pilus ATPase ComGA Machinery gene
  RF668_RS04160 (RF668_04160) comGB 824829..825854 (+) 1026 WP_052206589.1 competence type IV pilus assembly protein ComGB Machinery gene
  RF668_RS04165 (RF668_04165) comGC 825898..826197 (+) 300 WP_052206590.1 competence type IV pilus major pilin ComGC Machinery gene
  RF668_RS04170 (RF668_04170) comGD 826208..826639 (+) 432 WP_050750513.1 competence type IV pilus minor pilin ComGD Machinery gene
  RF668_RS04175 (RF668_04175) comGE 826611..826907 (+) 297 WP_043736169.1 competence type IV pilus minor pilin ComGE Machinery gene
  RF668_RS04180 (RF668_04180) comGF 826891..827316 (+) 426 WP_374049086.1 competence type IV pilus minor pilin ComGF Machinery gene
  RF668_RS04185 (RF668_04185) comGG 827340..827639 (+) 300 WP_021037947.1 competence type IV pilus minor pilin ComGG Machinery gene
  RF668_RS04190 (RF668_04190) - 827720..828157 (+) 438 WP_011677180.1 zinc-dependent MarR family transcriptional regulator -
  RF668_RS04195 (RF668_04195) - 828154..828996 (+) 843 WP_011677179.1 metal ABC transporter solute-binding protein, Zn/Mn family -
  RF668_RS04200 (RF668_04200) - 829175..829912 (+) 738 WP_011836039.1 metal ABC transporter ATP-binding protein -
  RF668_RS04205 (RF668_04205) - 829905..830714 (+) 810 WP_011677177.1 metal ABC transporter permease -
  RF668_RS04210 (RF668_04210) - 830736..831608 (-) 873 WP_043736178.1 RluA family pseudouridine synthase -
  RF668_RS04215 (RF668_04215) - 831803..832180 (+) 378 WP_041168662.1 pyridoxamine 5'-phosphate oxidase family protein -

Sequence


Protein


Download         Length: 99 a.a.        Molecular weight: 11269.27 Da        Isoelectric Point: 9.8236

>NTDB_id=876872 RF668_RS04185 WP_021037947.1 827340..827639(+) (comGG) [Lactococcus cremoris strain KCKM 0438]
MVLLLIFSLFLQFYLQKQVLTAQQLKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSN
KTYCFDVRLKDGRIFQIKK

Nucleotide


Download         Length: 300 bp        

>NTDB_id=876872 RF668_RS04185 WP_021037947.1 827340..827639(+) (comGG) [Lactococcus cremoris strain KCKM 0438]
TTGGTTTTACTGCTAATTTTTTCTTTATTTCTACAGTTTTATTTGCAAAAACAGGTGCTTACAGCTCAGCAATTGAAAAT
AGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCAACTTAATT
TTGATTGTGGAAATTTAACTTATAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTGTTAGTAAT
AAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTTTCAAATAAAAAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

100

100

1