Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   RF667_RS00840 Genome accession   NZ_CP133786
Coordinates   141142..141585 (+) Length   147 a.a.
NCBI ID   WP_194959150.1    Uniprot ID   -
Organism   Lacticaseibacillus paracasei strain KCKM 0245     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 133032..177990 141142..141585 within 0


Gene organization within MGE regions


Location: 133032..177990
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RF667_RS00770 (RF667_00770) - 133032..134201 (-) 1170 WP_194959139.1 site-specific integrase -
  RF667_RS00775 (RF667_00775) - 134376..135008 (-) 633 WP_228768588.1 hypothetical protein -
  RF667_RS00780 (RF667_00780) - 135065..135835 (-) 771 WP_228768607.1 XRE family transcriptional regulator -
  RF667_RS00785 (RF667_00785) - 136036..136275 (+) 240 WP_194959141.1 helix-turn-helix transcriptional regulator -
  RF667_RS00790 (RF667_00790) - 136310..137128 (+) 819 WP_194959142.1 ORF6N domain-containing protein -
  RF667_RS00795 (RF667_00795) - 137125..137274 (+) 150 WP_021354148.1 hypothetical protein -
  RF667_RS00800 (RF667_00800) - 137340..137564 (+) 225 WP_194959143.1 hypothetical protein -
  RF667_RS00805 (RF667_00805) - 137548..138039 (-) 492 WP_211772729.1 DUF2321 domain-containing protein -
  RF667_RS00810 (RF667_00810) - 138101..138424 (+) 324 WP_194959145.1 DUF771 domain-containing protein -
  RF667_RS00815 (RF667_00815) - 138506..138658 (+) 153 WP_016375940.1 hypothetical protein -
  RF667_RS00820 (RF667_00820) - 138663..138866 (+) 204 WP_194959146.1 hypothetical protein -
  RF667_RS00825 (RF667_00825) - 138884..139771 (+) 888 WP_194959147.1 DUF1351 domain-containing protein -
  RF667_RS00830 (RF667_00830) - 139768..140484 (+) 717 WP_249322084.1 ERF family protein -
  RF667_RS00835 (RF667_00835) - 140459..141127 (+) 669 WP_194959149.1 putative HNHc nuclease -
  RF667_RS00840 (RF667_00840) ssb 141142..141585 (+) 444 WP_194959150.1 single-stranded DNA-binding protein Machinery gene
  RF667_RS00845 (RF667_00845) - 141600..142397 (+) 798 WP_194959151.1 replication protein -
  RF667_RS00850 (RF667_00850) - 142384..143166 (+) 783 WP_194959152.1 ATP-binding protein -
  RF667_RS00855 (RF667_00855) - 143163..143495 (+) 333 WP_194959153.1 hypothetical protein -
  RF667_RS00860 (RF667_00860) - 143492..143830 (+) 339 WP_194959257.1 hypothetical protein -
  RF667_RS00865 (RF667_00865) - 143942..144157 (+) 216 WP_004562022.1 helix-turn-helix transcriptional regulator -
  RF667_RS00870 (RF667_00870) - 144154..144603 (+) 450 WP_194959154.1 hypothetical protein -
  RF667_RS00875 (RF667_00875) - 144606..144989 (+) 384 WP_194959155.1 DUF1064 domain-containing protein -
  RF667_RS00880 (RF667_00880) - 145001..145711 (+) 711 WP_194959156.1 N-6 DNA methylase -
  RF667_RS00885 (RF667_00885) - 145698..146621 (+) 924 WP_194959157.1 site-specific integrase -
  RF667_RS00890 (RF667_00890) - 146632..147210 (+) 579 WP_194959158.1 hypothetical protein -
  RF667_RS00895 (RF667_00895) - 147234..147344 (+) 111 WP_005686930.1 hypothetical protein -
  RF667_RS00900 (RF667_00900) - 147341..147895 (+) 555 WP_194959159.1 DUF1642 domain-containing protein -
  RF667_RS00905 (RF667_00905) - 147885..148097 (+) 213 WP_194959160.1 hypothetical protein -
  RF667_RS00910 (RF667_00910) - 148090..148296 (+) 207 WP_032799897.1 hypothetical protein -
  RF667_RS00915 (RF667_00915) - 148293..148679 (+) 387 WP_194959161.1 hypothetical protein -
  RF667_RS00920 (RF667_00920) - 148676..149188 (+) 513 WP_194959162.1 hypothetical protein -
  RF667_RS00925 (RF667_00925) - 149185..149616 (+) 432 WP_194959163.1 YopX family protein -
  RF667_RS00930 (RF667_00930) - 149603..149821 (+) 219 WP_194959164.1 hypothetical protein -
  RF667_RS00935 (RF667_00935) - 149823..150041 (+) 219 WP_194959244.1 helix-turn-helix domain-containing protein -
  RF667_RS00940 (RF667_00940) - 150115..150543 (+) 429 WP_096835937.1 ArpU family phage packaging/lysis transcriptional regulator -
  RF667_RS00950 (RF667_00950) - 150900..152048 (+) 1149 WP_194959165.1 GcrA family cell cycle regulator -
  RF667_RS00955 (RF667_00955) - 152041..153024 (+) 984 WP_194959166.1 adenine-specific methyltransferase EcoRI family protein -
  RF667_RS00960 (RF667_00960) - 153017..153340 (+) 324 WP_194959167.1 ribonucleoside-diphosphate reductase -
  RF667_RS00965 (RF667_00965) - 153343..153666 (+) 324 WP_194959168.1 hypothetical protein -
  RF667_RS00970 (RF667_00970) - 153700..153951 (+) 252 Protein_157 hypothetical protein -
  RF667_RS00975 (RF667_00975) - 153941..154735 (+) 795 WP_194959169.1 HNH endonuclease -
  RF667_RS00980 (RF667_00980) - 154936..155367 (+) 432 WP_194959170.1 P27 family phage terminase small subunit -
  RF667_RS01000 (RF667_01000) - 157993..159705 (+) 1713 WP_194959173.1 terminase large subunit -
  RF667_RS01005 (RF667_01005) - 159717..159908 (+) 192 WP_003661399.1 hypothetical protein -
  RF667_RS01010 (RF667_01010) - 159914..161167 (+) 1254 WP_194959174.1 phage portal protein -
  RF667_RS01015 (RF667_01015) - 161121..161750 (+) 630 WP_194959175.1 HK97 family phage prohead protease -
  RF667_RS01020 (RF667_01020) - 161792..162994 (+) 1203 WP_194959176.1 phage major capsid protein -
  RF667_RS01025 (RF667_01025) - 163012..163251 (+) 240 WP_005712764.1 Ig-like domain-containing protein -
  RF667_RS01030 (RF667_01030) - 163262..163621 (+) 360 WP_016377451.1 head-tail connector protein -
  RF667_RS01035 (RF667_01035) - 163611..163940 (+) 330 WP_003661388.1 head-tail adaptor protein -
  RF667_RS01040 (RF667_01040) - 163940..164326 (+) 387 WP_194959177.1 HK97-gp10 family putative phage morphogenesis protein -
  RF667_RS01045 (RF667_01045) - 164326..164712 (+) 387 WP_016363186.1 hypothetical protein -
  RF667_RS01050 (RF667_01050) - 164746..165363 (+) 618 WP_194958563.1 major tail protein -
  RF667_RS01055 (RF667_01055) gpG 165462..165875 (+) 414 WP_101512059.1 phage tail assembly chaperone G -
  RF667_RS01060 (RF667_01060) - 165998..170839 (+) 4842 WP_194959178.1 phage tail tape measure protein -
  RF667_RS01065 (RF667_01065) - 170840..173119 (+) 2280 WP_194959179.1 distal tail protein Dit -
  RF667_RS01070 (RF667_01070) - 173125..175578 (+) 2454 WP_194959180.1 phage tail protein -
  RF667_RS01075 (RF667_01075) - 175588..175911 (+) 324 WP_003573796.1 hypothetical protein -
  RF667_RS01080 (RF667_01080) - 175973..176035 (+) 63 WP_225424246.1 hypothetical protein -
  RF667_RS01085 (RF667_01085) - 176066..176356 (+) 291 WP_003573802.1 hypothetical protein -
  RF667_RS01090 (RF667_01090) - 176349..176795 (+) 447 WP_003573804.1 phage holin -
  RF667_RS01095 (RF667_01095) - 176806..177990 (+) 1185 WP_194959181.1 GH25 family lysozyme -

Sequence


Protein


Download         Length: 147 a.a.        Molecular weight: 16151.84 Da        Isoelectric Point: 5.1237

>NTDB_id=876818 RF667_RS00840 WP_194959150.1 141142..141585(+) (ssb) [Lacticaseibacillus paracasei strain KCKM 0245]
MLNSVALTGRLTKPVDLRYTQSGTAVGSFTIAVDRQFRSANGERETDFINCAIWRKSAENFANFTHKGSLVGIEGHIQTR
TYDNAQGQRVYVTEVIVENFALLEPKGSSQGQPTQPTNQGYVGNQPANYTQPPASQPIDISDDDLPF

Nucleotide


Download         Length: 444 bp        

>NTDB_id=876818 RF667_RS00840 WP_194959150.1 141142..141585(+) (ssb) [Lacticaseibacillus paracasei strain KCKM 0245]
ATGCTTAATTCAGTTGCTTTAACAGGCAGATTAACTAAACCGGTTGATCTTCGCTATACGCAAAGTGGAACAGCAGTTGG
CTCATTTACTATTGCTGTTGATCGCCAATTTCGTAGCGCAAATGGGGAACGTGAAACTGACTTCATCAATTGTGCCATCT
GGCGTAAGTCTGCTGAGAATTTTGCCAACTTCACACATAAGGGTTCACTTGTTGGCATCGAAGGCCATATCCAAACGCGT
ACGTACGACAACGCACAGGGTCAACGAGTCTATGTGACCGAAGTCATCGTTGAGAATTTTGCGCTCTTGGAGCCTAAAGG
TTCATCGCAGGGACAACCAACTCAGCCGACTAATCAAGGATATGTGGGTAATCAACCAGCCAATTACACTCAACCGCCAG
CTAGTCAGCCAATCGATATCAGCGATGATGATCTTCCATTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

55.294

100

0.639

  ssbA Bacillus subtilis subsp. subtilis str. 168

48.588

100

0.585

  ssb Vibrio cholerae strain A1552

33.721

100

0.395

  ssbB Bacillus subtilis subsp. subtilis str. 168

54.717

72.109

0.395

  ssb Glaesserella parasuis strain SC1401

30.556

100

0.374