Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | RFF25_RS02680 | Genome accession | NZ_CP133633 |
| Coordinates | 585648..586097 (-) | Length | 149 a.a. |
| NCBI ID | WP_083002355.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain Pm1618 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 581913..632855 | 585648..586097 | within | 0 |
Gene organization within MGE regions
Location: 581913..632855
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RFF25_RS02655 (RFF25_02655) | - | 581913..582122 (+) | 210 | WP_005716039.1 | cold-shock protein | - |
| RFF25_RS02660 (RFF25_02660) | - | 582230..582640 (+) | 411 | Protein_499 | antitermination protein | - |
| RFF25_RS02665 (RFF25_02665) | - | 582744..583955 (-) | 1212 | WP_083002359.1 | tyrosine-type recombinase/integrase | - |
| RFF25_RS02670 (RFF25_02670) | - | 584264..584461 (-) | 198 | WP_014391107.1 | helix-turn-helix transcriptional regulator | - |
| RFF25_RS02675 (RFF25_02675) | - | 584521..585546 (-) | 1026 | WP_083002357.1 | FRG domain-containing protein | - |
| RFF25_RS02680 (RFF25_02680) | ssb | 585648..586097 (-) | 450 | WP_083002355.1 | single-stranded DNA-binding protein | Machinery gene |
| RFF25_RS02685 (RFF25_02685) | - | 586108..586809 (-) | 702 | WP_083002352.1 | ERF family protein | - |
| RFF25_RS02690 (RFF25_02690) | - | 586852..587502 (-) | 651 | WP_083002350.1 | ribonuclease H-like domain-containing protein | - |
| RFF25_RS02695 (RFF25_02695) | - | 587675..587836 (-) | 162 | WP_193757061.1 | hypothetical protein | - |
| RFF25_RS02700 (RFF25_02700) | - | 587846..588088 (-) | 243 | WP_083002348.1 | hypothetical protein | - |
| RFF25_RS02705 (RFF25_02705) | - | 588173..588784 (-) | 612 | WP_083002345.1 | KilA-N domain-containing protein | - |
| RFF25_RS02710 (RFF25_02710) | - | 589054..589881 (-) | 828 | WP_083002342.1 | BRO family protein | - |
| RFF25_RS02715 (RFF25_02715) | - | 589969..590994 (-) | 1026 | WP_083002339.1 | hypothetical protein | - |
| RFF25_RS02720 (RFF25_02720) | - | 591079..592047 (-) | 969 | WP_083002337.1 | reverse transcriptase family protein | - |
| RFF25_RS02725 (RFF25_02725) | - | 592022..592333 (-) | 312 | WP_083002334.1 | helix-turn-helix domain-containing protein | - |
| RFF25_RS02730 (RFF25_02730) | - | 593345..593572 (-) | 228 | WP_083002331.1 | hypothetical protein | - |
| RFF25_RS02735 (RFF25_02735) | - | 593814..594023 (-) | 210 | WP_005756656.1 | hypothetical protein | - |
| RFF25_RS02740 (RFF25_02740) | - | 594036..594203 (+) | 168 | WP_005756653.1 | YegP family protein | - |
| RFF25_RS02745 (RFF25_02745) | - | 594512..594826 (+) | 315 | WP_083002329.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| RFF25_RS02750 (RFF25_02750) | - | 594823..595113 (+) | 291 | WP_083002326.1 | addiction module antidote protein | - |
| RFF25_RS02755 (RFF25_02755) | - | 595139..595978 (-) | 840 | WP_083002324.1 | BRO family protein | - |
| RFF25_RS02760 (RFF25_02760) | - | 596070..596756 (-) | 687 | WP_083002321.1 | XRE family transcriptional regulator | - |
| RFF25_RS02765 (RFF25_02765) | - | 596884..597093 (+) | 210 | WP_005720263.1 | helix-turn-helix transcriptional regulator | - |
| RFF25_RS02770 (RFF25_02770) | - | 597166..597594 (+) | 429 | WP_250190967.1 | phage regulatory CII family protein | - |
| RFF25_RS02775 (RFF25_02775) | - | 597597..598004 (-) | 408 | WP_227718008.1 | hypothetical protein | - |
| RFF25_RS02780 (RFF25_02780) | - | 598116..598346 (+) | 231 | WP_083002312.1 | helix-turn-helix domain-containing protein | - |
| RFF25_RS02785 (RFF25_02785) | - | 598439..599299 (+) | 861 | WP_083002309.1 | DNA replication protein | - |
| RFF25_RS02790 (RFF25_02790) | - | 599299..600738 (+) | 1440 | WP_250190968.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| RFF25_RS02795 (RFF25_02795) | - | 600742..601167 (+) | 426 | WP_083002302.1 | recombination protein NinB | - |
| RFF25_RS02800 (RFF25_02800) | - | 601241..601843 (+) | 603 | WP_083002299.1 | recombination protein NinG | - |
| RFF25_RS02805 (RFF25_02805) | - | 601844..602305 (+) | 462 | WP_083002297.1 | antiterminator Q family protein | - |
| RFF25_RS02810 (RFF25_02810) | - | 602430..602993 (-) | 564 | WP_083002295.1 | hypothetical protein | - |
| RFF25_RS02815 (RFF25_02815) | - | 603111..603407 (+) | 297 | WP_081273045.1 | hypothetical protein | - |
| RFF25_RS02820 (RFF25_02820) | - | 603404..603934 (+) | 531 | WP_083002292.1 | lysozyme | - |
| RFF25_RS02825 (RFF25_02825) | - | 603907..604230 (+) | 324 | WP_083002289.1 | DUF2570 family protein | - |
| RFF25_RS02830 (RFF25_02830) | - | 604244..604417 (+) | 174 | WP_227718007.1 | lytic protein Rz1 | - |
| RFF25_RS02835 (RFF25_02835) | - | 604440..604808 (-) | 369 | WP_014391478.1 | helix-turn-helix domain-containing protein | - |
| RFF25_RS02840 (RFF25_02840) | - | 604844..605104 (-) | 261 | WP_064702795.1 | type II toxin-antitoxin system RelE family toxin | - |
| RFF25_RS02845 (RFF25_02845) | - | 605385..605864 (+) | 480 | WP_083002285.1 | DUF1441 family protein | - |
| RFF25_RS02850 (RFF25_02850) | - | 605864..607975 (+) | 2112 | WP_083002282.1 | phage terminase large subunit family protein | - |
| RFF25_RS02855 (RFF25_02855) | - | 607972..608196 (+) | 225 | WP_083002279.1 | hypothetical protein | - |
| RFF25_RS02860 (RFF25_02860) | - | 608280..608441 (+) | 162 | WP_167383052.1 | hypothetical protein | - |
| RFF25_RS02865 (RFF25_02865) | - | 608466..609983 (+) | 1518 | Protein_540 | phage portal protein | - |
| RFF25_RS02870 (RFF25_02870) | - | 609922..611955 (+) | 2034 | WP_083002276.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| RFF25_RS02875 (RFF25_02875) | - | 612023..612349 (+) | 327 | WP_083002274.1 | DUF2190 family protein | - |
| RFF25_RS02880 (RFF25_02880) | - | 612342..612644 (+) | 303 | WP_083002271.1 | phage tail protein | - |
| RFF25_RS02885 (RFF25_02885) | - | 612648..613175 (+) | 528 | WP_083002269.1 | phage tail protein | - |
| RFF25_RS02890 (RFF25_02890) | gpU | 613175..613585 (+) | 411 | WP_083002267.1 | phage tail terminator protein | - |
| RFF25_RS02895 (RFF25_02895) | - | 613585..614235 (+) | 651 | WP_083002264.1 | hypothetical protein | - |
| RFF25_RS02900 (RFF25_02900) | - | 614291..614683 (+) | 393 | WP_083002262.1 | hypothetical protein | - |
| RFF25_RS02905 (RFF25_02905) | - | 614752..614979 (+) | 228 | WP_083005723.1 | DUF4035 domain-containing protein | - |
| RFF25_RS02910 (RFF25_02910) | - | 615061..615606 (+) | 546 | WP_083002260.1 | hypothetical protein | - |
| RFF25_RS02915 (RFF25_02915) | - | 615970..616488 (+) | 519 | WP_083002258.1 | hypothetical protein | - |
| RFF25_RS02920 (RFF25_02920) | - | 616490..616984 (+) | 495 | WP_083002255.1 | type VI secretion system-associated protein TagO | - |
| RFF25_RS02925 (RFF25_02925) | - | 617146..619104 (+) | 1959 | WP_083002252.1 | ATP-binding protein | - |
| RFF25_RS02930 (RFF25_02930) | - | 619409..620080 (+) | 672 | WP_083002249.1 | KilA-N domain-containing protein | - |
| RFF25_RS02935 (RFF25_02935) | - | 620135..620488 (+) | 354 | WP_083002247.1 | DUF2513 domain-containing protein | - |
| RFF25_RS02940 (RFF25_02940) | - | 620547..620798 (+) | 252 | WP_083002244.1 | hypothetical protein | - |
| RFF25_RS02945 (RFF25_02945) | - | 620857..624138 (+) | 3282 | WP_083002241.1 | tape measure protein | - |
| RFF25_RS02950 (RFF25_02950) | - | 624135..624563 (+) | 429 | WP_227718006.1 | phage tail protein | - |
| RFF25_RS02955 (RFF25_02955) | - | 624556..625371 (+) | 816 | WP_083002238.1 | collagen-like protein | - |
| RFF25_RS02960 (RFF25_02960) | - | 625380..625964 (+) | 585 | WP_083002236.1 | DUF4376 domain-containing protein | - |
| RFF25_RS02965 (RFF25_02965) | - | 625951..626217 (+) | 267 | WP_083002233.1 | DNA helicase UvrD | - |
| RFF25_RS02970 (RFF25_02970) | - | 626226..626939 (+) | 714 | WP_083002230.1 | phage minor tail protein L | - |
| RFF25_RS02975 (RFF25_02975) | - | 626942..627676 (+) | 735 | WP_083002227.1 | C40 family peptidase | - |
| RFF25_RS02980 (RFF25_02980) | - | 627619..628242 (+) | 624 | WP_250190970.1 | tail assembly protein | - |
| RFF25_RS02985 (RFF25_02985) | - | 628246..631587 (+) | 3342 | WP_083002222.1 | host specificity protein J | - |
| RFF25_RS02990 (RFF25_02990) | - | 631608..632855 (-) | 1248 | WP_250190971.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 16773.58 Da Isoelectric Point: 6.9823
>NTDB_id=875324 RFF25_RS02680 WP_083002355.1 585648..586097(-) (ssb) [Pasteurella multocida strain Pm1618]
MAGVNKVIIVGNLGNDPDVRTMPNGEAVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQPQAPAPQNNAYANAKAGKPAQQQADSFEDDNIPF
MAGVNKVIIVGNLGNDPDVRTMPNGEAVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQPQAPAPQNNAYANAKAGKPAQQQADSFEDDNIPF
Nucleotide
Download Length: 450 bp
>NTDB_id=875324 RFF25_RS02680 WP_083002355.1 585648..586097(-) (ssb) [Pasteurella multocida strain Pm1618]
ATGGCTGGAGTAAATAAAGTAATTATAGTCGGGAATTTAGGAAACGATCCTGATGTCCGCACAATGCCAAATGGCGAAGC
AGTGGCAAAAATCAGCGTCGCAACTAGTGAAAGCTGGATAGACAAAAACACGAACGAGCGCAAAACACAAACTGAATGGC
ACTCTATCGTGTTCTATCGCAGACAAGCAGAAATTTGCGGCCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGATCGCTACACAACTGAAATCCAAGGTGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCGCAACCGCAAGCACCGGCACCACAAAACAACGCTTATGCAAATGCGAAAGCTGGAAAGC
CAGCACAGCAACAAGCAGATAGCTTTGAAGACGACAATATACCGTTCTGA
ATGGCTGGAGTAAATAAAGTAATTATAGTCGGGAATTTAGGAAACGATCCTGATGTCCGCACAATGCCAAATGGCGAAGC
AGTGGCAAAAATCAGCGTCGCAACTAGTGAAAGCTGGATAGACAAAAACACGAACGAGCGCAAAACACAAACTGAATGGC
ACTCTATCGTGTTCTATCGCAGACAAGCAGAAATTTGCGGCCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGATCGCTACACAACTGAAATCCAAGGTGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCGCAACCGCAAGCACCGGCACCACAAAACAACGCTTATGCAAATGCGAAAGCTGGAAAGC
CAGCACAGCAACAAGCAGATAGCTTTGAAGACGACAATATACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
62.983 |
100 |
0.765 |
| ssb | Vibrio cholerae strain A1552 |
47.399 |
100 |
0.55 |
| ssb | Neisseria meningitidis MC58 |
48.507 |
89.933 |
0.436 |
| ssb | Neisseria gonorrhoeae MS11 |
48.507 |
89.933 |
0.436 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
31.395 |
100 |
0.362 |