NTDB

Overview

Name	comA	Type	Regulator
Locus tag	V5G00_RS00645	Genome accession	NZ_CP145080
Coordinates	138544..138825 (+)	Length	93 a.a.
NCBI ID	WP_003696701.1	Uniprot ID	A0A0H4IVZ5
Organism	Neisseria gonorrhoeae strain WHO_E_2024
Function	processing and transport of ComC (predicted from homology) Competence regulation

Genomic Context

Location: 133544..143825

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V5G00_RS00600 (V5G00_00605)	-	133649..134803 (+)	1155	WP_003690582.1	cupin domain-containing protein	-
V5G00_RS00605 (V5G00_00610)	-	134812..135039 (+)	228	WP_003696696.1	hypothetical protein	-
V5G00_RS00610 (V5G00_00615)	-	135114..135386 (+)	273	WP_226888059.1	hypothetical protein	-
V5G00_RS00615 (V5G00_00620)	-	135447..136721 (+)	1275	WP_353426049.1	HlyD family efflux transporter periplasmic adaptor subunit	-
V5G00_RS00620 (V5G00_00625)	-	136906..137253 (+)	348	WP_003687399.1	hypothetical protein	-
V5G00_RS00625 (V5G00_00630)	-	137267..137482 (+)	216	WP_003687400.1	hypothetical protein	-
V5G00_RS00630 (V5G00_00635)	-	137584..138135 (+)	552	Protein_123	cysteine peptidase family C39 domain-containing protein	-
V5G00_RS00635 (V5G00_00640)	-	138121..138351 (+)	231	WP_225577515.1	ATP-binding cassette domain-containing protein	-
V5G00_RS00640 (V5G00_00645)	-	138349..138465 (-)	117	Protein_125	IS5/IS1182 family transposase	-
V5G00_RS00645 (V5G00_00650)	comA	138544..138825 (+)	282	WP_003696701.1	ATP-binding cassette domain-containing protein	Regulator
V5G00_RS00650 (V5G00_00655)	-	138846..140072 (-)	1227	WP_003696703.1	YihY family inner membrane protein	-
V5G00_RS00655 (V5G00_00660)	-	140171..140376 (+)	206	Protein_128	NAD(P)H-quinone oxidoreductase	-
V5G00_RS00660 (V5G00_00665)	queC	140561..141220 (+)	660	WP_003692586.1	7-cyano-7-deazaguanine synthase QueC	-
V5G00_RS00665 (V5G00_00670)	-	141248..141763 (+)	516	WP_003687408.1	DUF1543 domain-containing protein	-
V5G00_RS00670 (V5G00_00675)	queD	141851..142273 (+)	423	WP_003696705.1	6-carboxytetrahydropterin synthase QueD	-
V5G00_RS00675 (V5G00_00680)	-	142539..142907 (+)	369	WP_003694785.1	DUF1304 domain-containing protein	-
V5G00_RS00680 (V5G00_00685)	-	142904..143542 (+)	639	WP_003696707.1	7-carboxy-7-deazaguanine synthase QueE	-

Sequence

Protein

Download Length: 93 a.a. Molecular weight: 10117.78 Da Isoelectric Point: 6.4598

                                >NTDB_id=850184 V5G00_RS00645 WP_003696701.1 138544..138825(+) (comA) [Neisseria gonorrhoeae strain WHO_E_2024]

MIREEISAMPMGYETLIGDMGSALSGGQKQRIVLARALYCEPKILFLDEAASHLDIANEKAVNANLNGLSIIKIMAAHRK

ETVESADRKMSLG

Nucleotide

Download Length: 282 bp

                                >NTDB_id=850184 V5G00_RS00645 WP_003696701.1 138544..138825(+) (comA) [Neisseria gonorrhoeae strain WHO_E_2024]

ATGATTCGCGAAGAAATCTCCGCCATGCCTATGGGCTATGAAACCTTGATCGGCGATATGGGCAGCGCACTGTCAGGCGG

ACAAAAACAACGTATCGTATTGGCGCGGGCCTTATATTGCGAACCGAAAATCCTATTTTTAGATGAAGCGGCCAGTCATT

TGGATATTGCCAATGAAAAAGCAGTCAATGCAAACTTGAATGGCTTGTCTATTATAAAAATTATGGCGGCACACAGAAAG

GAAACGGTGGAATCAGCAGATAGGAAAATGTCTTTAGGATAA

Domains

Predicted by InterProScan.

ABC transporter (ABC_tran)

(14-51)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A0H4IVZ5

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comA	Streptococcus mitis SK321	46.154	97.849	0.452
comA	Streptococcus mitis NCTC 12261	45.055	97.849	0.441
comA	Streptococcus pneumoniae TIGR4	45.055	97.849	0.441
comA	Streptococcus pneumoniae Rx1	45.055	97.849	0.441
comA	Streptococcus pneumoniae R6	45.055	97.849	0.441
comA	Streptococcus pneumoniae D39	45.055	97.849	0.441
comA/nlmT	Streptococcus mutans UA159	47.126	93.548	0.441
comA	Streptococcus gordonii str. Challis substr. CH1	43.956	97.849	0.43

Detailed information NTG0850184