NTDB

Overview

Name	comGF	Type	Machinery gene
Locus tag	QQO11_RS08510	Genome accession	NZ_CP127019
Coordinates	1719839..1720336 (-)	Length	165 a.a.
NCBI ID	WP_001803317.1	Uniprot ID	A0A2I7Y542
Organism	Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-009_371M
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1714839..1725336

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QQO11_RS08485 (QQO11_08485)	gcvPB	1715001..1716473 (-)	1473	WP_000202189.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPB	-
QQO11_RS08490 (QQO11_08490)	gcvPA	1716466..1717812 (-)	1347	WP_000019687.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
QQO11_RS08495 (QQO11_08495)	gcvT	1717832..1718923 (-)	1092	WP_000093351.1	glycine cleavage system aminomethyltransferase GcvT	-
QQO11_RS08500 (QQO11_08500)	-	1719082..1719606 (-)	525	WP_001015117.1	shikimate kinase	-
QQO11_RS08505 (QQO11_08505)	-	1719596..1719742 (-)	147	WP_001789879.1	hypothetical protein	-
QQO11_RS08510 (QQO11_08510)	comGF	1719839..1720336 (-)	498	WP_001803317.1	competence type IV pilus minor pilin ComGF	Machinery gene
QQO11_RS08515 (QQO11_08515)	comGE	1720254..1720553 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
QQO11_RS08520 (QQO11_08520)	comGD	1720540..1720986 (-)	447	WP_001790850.1	competence type IV pilus minor pilin ComGD	Machinery gene
QQO11_RS08525 (QQO11_08525)	comGC	1720964..1721275 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
QQO11_RS08530 (QQO11_08530)	comGB	1721289..1722359 (-)	1071	WP_000775706.1	competence type IV pilus assembly protein ComGB	Machinery gene
QQO11_RS08535 (QQO11_08535)	comGA	1722331..1723305 (-)	975	WP_000697228.1	competence type IV pilus ATPase ComGA	Machinery gene
QQO11_RS08540 (QQO11_08540)	-	1723357..1723980 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
QQO11_RS08545 (QQO11_08545)	-	1723977..1724306 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
QQO11_RS08550 (QQO11_08550)	-	1724306..1725292 (-)	987	WP_000161314.1	ROK family glucokinase	-

Sequence

Protein

Download Length: 165 a.a. Molecular weight: 19212.92 Da Isoelectric Point: 10.2192

                                >NTDB_id=841283 QQO11_RS08510 WP_001803317.1 1719839..1720336(-) (comGF) [Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-009_371M]

MILSKVTNKFVLFQKIPLLIKRHVYSINVKAFSLIEMLVAMMFISITLLIVPDLIRLSKTFLIESRDLTTVDFEFFSRDI

LDDFKGVDRNDIEIRQHRIILHKGEEMIEYKLINNKIIKVVNDRGNITMINNVTAFTANIYYKSIIKITITVKVGTNVQT

KTIYV

Nucleotide

Download Length: 498 bp

                                >NTDB_id=841283 QQO11_RS08510 WP_001803317.1 1719839..1720336(-) (comGF) [Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-009_371M]

ATGATATTAAGCAAAGTGACCAACAAATTTGTGCTATTTCAAAAAATACCACTTCTTATCAAAAGACATGTATACAGTAT

TAATGTCAAAGCTTTTTCGCTCATTGAAATGTTAGTAGCGATGATGTTTATAAGTATAACTTTACTAATTGTTCCAGACT

TAATTAGACTTAGTAAAACTTTTCTAATTGAAAGTAGGGATTTAACAACTGTAGATTTCGAATTTTTCTCAAGAGATATT

CTAGATGATTTTAAAGGAGTAGATAGAAACGATATTGAAATTAGGCAACACCGTATCATTTTACATAAAGGTGAAGAAAT

GATCGAATACAAATTAATTAATAATAAAATTATTAAAGTTGTAAATGACAGAGGAAATATAACAATGATTAATAATGTTA

CAGCATTTACTGCAAATATCTACTATAAATCCATTATTAAAATAACGATAACAGTTAAAGTCGGTACAAATGTGCAGACT

AAAACTATTTATGTATAA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(67-155)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A2I7Y542

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGF	Staphylococcus aureus MW2	99.394	100	0.994
comGF	Staphylococcus aureus N315	95.758	100	0.958

Detailed information NTG0841283