Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | F0329_RS00585 | Genome accession | NZ_CP126605 |
| Coordinates | 111011..111496 (-) | Length | 161 a.a. |
| NCBI ID | WP_000157061.1 | Uniprot ID | A0AAU7IP99 |
| Organism | Citrobacter werkmanii strain C5.1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 66477..120209 | 111011..111496 | within | 0 |
Gene organization within MGE regions
Location: 66477..120209
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F0329_RS00330 (F0329_00330) | - | 66477..67307 (-) | 831 | WP_001334766.1 | oxacillin-hydrolyzing class D beta-lactamase OXA-1 | - |
| F0329_RS00335 (F0329_00335) | intI1 | 67517..68530 (+) | 1014 | WP_000845048.1 | class 1 integron integrase IntI1 | - |
| F0329_RS00340 (F0329_00340) | - | 68517..69122 (-) | 606 | WP_048228299.1 | hypothetical protein | - |
| F0329_RS00345 (F0329_00345) | dfrA19 | 69133..69702 (-) | 570 | WP_000019304.1 | trimethoprim-resistant dihydrofolate reductase DfrA19 | - |
| F0329_RS00350 (F0329_00350) | - | 69702..70166 (-) | 465 | WP_000645230.1 | BRCT domain-containing protein | - |
| F0329_RS00355 (F0329_00355) | - | 70468..70890 (-) | 423 | Protein_70 | IS91 family transposase | - |
| F0329_RS00360 (F0329_00360) | - | 70987..72528 (-) | 1542 | WP_000050481.1 | IS91-like element ISCR1 family transposase | - |
| F0329_RS00365 (F0329_00365) | sul1 | 72933..73772 (-) | 840 | WP_000259031.1 | sulfonamide-resistant dihydropteroate synthase Sul1 | - |
| F0329_RS00370 (F0329_00370) | - | 73766..74113 (-) | 348 | WP_000679427.1 | quaternary ammonium compound efflux SMR transporter QacE delta 1 | - |
| F0329_RS00375 (F0329_00375) | - | 74270..74902 (-) | 633 | WP_000186237.1 | type B-3 chloramphenicol O-acetyltransferase CatB3 | - |
| F0329_RS00380 (F0329_00380) | aadB | 74985..75518 (-) | 534 | WP_000381802.1 | aminoglycoside nucleotidyltransferase ANT(2'')-Ia | - |
| F0329_RS00385 (F0329_00385) | intI1 | 75664..76677 (+) | 1014 | WP_000845039.1 | class 1 integron integrase IntI1 | - |
| F0329_RS00390 | - | 76880..77230 (+) | 351 | Protein_77 | DUF3330 domain-containing protein | - |
| F0329_RS00395 (F0329_00400) | - | 77356..77916 (+) | 561 | WP_000147567.1 | recombinase family protein | - |
| F0329_RS00400 (F0329_00405) | - | 77919..80885 (+) | 2967 | WP_001138064.1 | Tn3-like element TnAs3 family transposase | - |
| F0329_RS00405 (F0329_00410) | - | 80952..81329 (+) | 378 | WP_000656305.1 | GNAT family N-acetyltransferase | - |
| F0329_RS00410 (F0329_00415) | - | 81530..82189 (-) | 660 | WP_000412211.1 | type A-1 chloramphenicol O-acetyltransferase | - |
| F0329_RS00415 (F0329_00420) | - | 82468..83165 (+) | 698 | WP_095033700.1 | IS1-like element IS1B family transposase | - |
| F0329_RS00420 (F0329_00425) | - | 83162..83425 (+) | 264 | WP_049802299.1 | antibiotic biosynthesis monooxygenase | - |
| F0329_RS00425 (F0329_00430) | - | 83418..83804 (+) | 387 | WP_000460651.1 | hypothetical protein | - |
| F0329_RS00430 (F0329_00435) | - | 83812..84498 (+) | 687 | WP_001284954.1 | winged helix-turn-helix domain-containing protein | - |
| F0329_RS00435 (F0329_00440) | tetR(B) | 84476..85099 (-) | 624 | WP_000088605.1 | tetracycline resistance transcriptional repressor TetR(B) | - |
| F0329_RS00440 (F0329_00445) | tet(B) | 85181..86386 (+) | 1206 | WP_129694983.1 | tetracycline efflux MFS transporter Tet(B) | - |
| F0329_RS00445 (F0329_00450) | tetC | 86499..87092 (-) | 594 | WP_000428546.1 | tetracyline resistance-associated transcriptional repressor TetC | - |
| F0329_RS00450 (F0329_00455) | - | 87180..87596 (+) | 417 | WP_000275180.1 | helix-turn-helix domain-containing protein | - |
| F0329_RS00455 (F0329_00460) | - | 87606..88769 (-) | 1164 | Protein_90 | IS4-like element ISVsa5 family transposase | - |
| F0329_RS00465 | - | 89836..89922 (+) | 87 | WP_089627921.1 | transposase | - |
| F0329_RS00470 (F0329_00475) | - | 90118..90438 (-) | 321 | Protein_93 | GTPase | - |
| F0329_RS00475 (F0329_00480) | - | 90522..91439 (-) | 918 | WP_135113592.1 | hypothetical protein | - |
| F0329_RS00480 | - | 92536..92732 (+) | 197 | Protein_95 | hypothetical protein | - |
| F0329_RS00485 (F0329_00485) | - | 92638..93240 (-) | 603 | WP_149282298.1 | hypothetical protein | - |
| F0329_RS00490 (F0329_00490) | - | 93334..93540 (-) | 207 | WP_179957931.1 | AlpA family phage regulatory protein | - |
| F0329_RS00495 (F0329_00495) | hha | 94265..94477 (+) | 213 | WP_087901481.1 | hemolysin expression modulator Hha | - |
| F0329_RS00500 (F0329_00500) | - | 95110..95679 (+) | 570 | WP_123001625.1 | inovirus Gp2 family protein | - |
| F0329_RS00505 (F0329_00505) | - | 95939..96322 (+) | 384 | WP_143361722.1 | putative zinc ribbon protein | - |
| F0329_RS00510 (F0329_00510) | - | 96319..96744 (+) | 426 | WP_087901757.1 | putative zinc ribbon protein | - |
| F0329_RS00515 (F0329_00515) | - | 97397..97492 (+) | 96 | Protein_102 | AlpA family transcriptional regulator | - |
| F0329_RS00520 (F0329_00520) | - | 97493..98467 (-) | 975 | Protein_103 | IS66 family transposase | - |
| F0329_RS00525 (F0329_00525) | tnpB | 98492..98827 (-) | 336 | Protein_104 | IS66 family insertion sequence element accessory protein TnpB | - |
| F0329_RS00530 (F0329_00530) | - | 98814..99143 (-) | 330 | WP_040235205.1 | hypothetical protein | - |
| F0329_RS00535 (F0329_00535) | - | 99250..100167 (-) | 918 | WP_087901758.1 | LysR substrate-binding domain-containing protein | - |
| F0329_RS00540 (F0329_00540) | dcuC | 100303..101574 (+) | 1272 | WP_040235202.1 | C4-dicarboxylate transporter DcuC | - |
| F0329_RS00545 (F0329_00545) | - | 101587..102897 (+) | 1311 | WP_087901759.1 | amidohydrolase | - |
| F0329_RS00550 (F0329_00550) | - | 103397..103822 (+) | 426 | WP_038635492.1 | transposase | - |
| F0329_RS00555 (F0329_00555) | tnpB | 103819..104169 (+) | 351 | WP_038635488.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| F0329_RS00560 (F0329_00560) | - | 104200..105624 (+) | 1425 | Protein_111 | IS66 family transposase | - |
| F0329_RS00565 (F0329_00565) | - | 105855..106593 (+) | 739 | Protein_112 | IS3 family transposase | - |
| F0329_RS00570 (F0329_00570) | ltrA | 107266..108774 (+) | 1509 | WP_038635474.1 | group II intron reverse transcriptase/maturase | - |
| F0329_RS00575 (F0329_00575) | - | 108864..109337 (+) | 474 | Protein_114 | IS3 family transposase | - |
| F0329_RS00580 (F0329_00580) | - | 109378..110960 (-) | 1583 | Protein_115 | conjugal transfer protein TrbC | - |
| F0329_RS00585 (F0329_00585) | ssb | 111011..111496 (-) | 486 | WP_000157061.1 | single-stranded DNA-binding protein | Machinery gene |
| F0329_RS00590 (F0329_00590) | - | 112144..114525 (-) | 2382 | WP_038635468.1 | glycoside hydrolase family 31 protein | - |
| F0329_RS00595 (F0329_00595) | - | 114540..115841 (-) | 1302 | WP_001329026.1 | MFS transporter | - |
| F0329_RS00600 (F0329_00600) | - | 116103..117173 (+) | 1071 | WP_000412404.1 | LacI family DNA-binding transcriptional regulator | - |
| F0329_RS00605 (F0329_00605) | - | 117571..118614 (-) | 1044 | WP_000999850.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 161 a.a. Molecular weight: 17685.62 Da Isoelectric Point: 7.2017
>NTDB_id=839080 F0329_RS00585 WP_000157061.1 111011..111496(-) (ssb) [Citrobacter werkmanii strain C5.1]
MASKGINKVILIGYLGQDPDIRYMPNGGAVASIALATSETWRDKQTGEMREQTEWHRVVLFGKLAEVASEYLRKGAQVYI
DGQLRTRKWTDQTGQERYTTEVVVHTGGTMQMLGSRQNSAQGGRGQPQQPQQGRQFSGNSPSPGNTAMSGSFSDDDDSIP
F
MASKGINKVILIGYLGQDPDIRYMPNGGAVASIALATSETWRDKQTGEMREQTEWHRVVLFGKLAEVASEYLRKGAQVYI
DGQLRTRKWTDQTGQERYTTEVVVHTGGTMQMLGSRQNSAQGGRGQPQQPQQGRQFSGNSPSPGNTAMSGSFSDDDDSIP
F
Nucleotide
Download Length: 486 bp
>NTDB_id=839080 F0329_RS00585 WP_000157061.1 111011..111496(-) (ssb) [Citrobacter werkmanii strain C5.1]
ATGGCCTCTAAAGGTATTAACAAAGTTATTCTGATAGGGTATCTGGGTCAGGACCCGGATATTCGCTATATGCCAAACGG
CGGCGCTGTGGCCAGCATTGCGCTGGCCACCTCCGAAACCTGGCGGGACAAACAGACAGGGGAGATGCGGGAACAAACCG
AATGGCACCGCGTGGTGCTGTTCGGCAAACTGGCGGAAGTAGCCAGTGAATACCTGCGCAAAGGAGCTCAGGTGTACATC
GATGGTCAGCTGCGTACCCGAAAATGGACCGACCAGACCGGCCAGGAACGCTACACGACTGAAGTGGTGGTGCATACCGG
CGGTACCATGCAGATGCTGGGCTCCCGGCAGAATAGTGCACAGGGTGGCCGGGGACAGCCTCAACAACCACAACAGGGCA
GACAGTTTTCAGGTAATTCGCCATCTCCGGGCAATACCGCCATGTCCGGCAGTTTCAGCGACGATGACGACAGTATCCCG
TTCTAA
ATGGCCTCTAAAGGTATTAACAAAGTTATTCTGATAGGGTATCTGGGTCAGGACCCGGATATTCGCTATATGCCAAACGG
CGGCGCTGTGGCCAGCATTGCGCTGGCCACCTCCGAAACCTGGCGGGACAAACAGACAGGGGAGATGCGGGAACAAACCG
AATGGCACCGCGTGGTGCTGTTCGGCAAACTGGCGGAAGTAGCCAGTGAATACCTGCGCAAAGGAGCTCAGGTGTACATC
GATGGTCAGCTGCGTACCCGAAAATGGACCGACCAGACCGGCCAGGAACGCTACACGACTGAAGTGGTGGTGCATACCGG
CGGTACCATGCAGATGCTGGGCTCCCGGCAGAATAGTGCACAGGGTGGCCGGGGACAGCCTCAACAACCACAACAGGGCA
GACAGTTTTCAGGTAATTCGCCATCTCCGGGCAATACCGCCATGTCCGGCAGTTTCAGCGACGATGACGACAGTATCCCG
TTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
58.757 |
100 |
0.646 |
| ssb | Glaesserella parasuis strain SC1401 |
52.632 |
94.41 |
0.497 |
| ssb | Neisseria meningitidis MC58 |
41.477 |
100 |
0.453 |
| ssb | Neisseria gonorrhoeae MS11 |
41.477 |
100 |
0.453 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
32.402 |
100 |
0.36 |