Detailed information
Overview
| Name | comA/nlmT | Type | Regulator |
| Locus tag | QIH85_RS06495 | Genome accession | NZ_CP126010 |
| Coordinates | 1404068..1404211 (+) | Length | 47 a.a. |
| NCBI ID | WP_158332945.1 | Uniprot ID | - |
| Organism | Bradyrhizobium japonicum strain N03G-Bj | ||
| Function | transport of ComC (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| IS/Tn | 1404325..1405389 | 1404068..1404211 | flank | 114 |
Gene organization within MGE regions
Location: 1404068..1405389
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QIH85_RS06495 (QIH85_06495) | comA/nlmT | 1404068..1404211 (+) | 144 | WP_158332945.1 | hypothetical protein | Regulator |
| QIH85_RS06500 (QIH85_06500) | - | 1404325..1405389 (-) | 1065 | WP_026192128.1 | IS630-like element ISRj1 family transposase | - |
Sequence
Protein
Download Length: 47 a.a. Molecular weight: 5152.00 Da Isoelectric Point: 7.1631
>NTDB_id=834326 QIH85_RS06495 WP_158332945.1 1404068..1404211(+) (comA/nlmT) [Bradyrhizobium japonicum strain N03G-Bj]
MIAHRPATVLSCDRILVMDQGKIVEQGTHAELVAKNGLYARLQFEGA
MIAHRPATVLSCDRILVMDQGKIVEQGTHAELVAKNGLYARLQFEGA
Nucleotide
Download Length: 144 bp
>NTDB_id=834326 QIH85_RS06495 WP_158332945.1 1404068..1404211(+) (comA/nlmT) [Bradyrhizobium japonicum strain N03G-Bj]
GTGATCGCGCACCGGCCCGCCACCGTGCTGTCCTGCGACCGCATCCTGGTGATGGACCAGGGCAAGATCGTCGAGCAGGG
CACGCACGCCGAGCTCGTCGCCAAGAACGGGCTCTATGCGAGGCTGCAGTTCGAGGGCGCGTGA
GTGATCGCGCACCGGCCCGCCACCGTGCTGTCCTGCGACCGCATCCTGGTGATGGACCAGGGCAAGATCGTCGAGCAGGG
CACGCACGCCGAGCTCGTCGCCAAGAACGGGCTCTATGCGAGGCTGCAGTTCGAGGGCGCGTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA/nlmT | Streptococcus mutans UA159 |
58.537 |
87.234 |
0.511 |
| rcrQ | Streptococcus mutans UA159 |
54.762 |
89.362 |
0.489 |
| comA | Streptococcus pneumoniae TIGR4 |
51.22 |
87.234 |
0.447 |
| comA | Streptococcus pneumoniae Rx1 |
51.22 |
87.234 |
0.447 |
| comA | Streptococcus mitis NCTC 12261 |
51.22 |
87.234 |
0.447 |
| comA | Streptococcus pneumoniae D39 |
51.22 |
87.234 |
0.447 |
| comA | Streptococcus pneumoniae R6 |
51.22 |
87.234 |
0.447 |
| rcrP | Streptococcus mutans UA159 |
47.727 |
93.617 |
0.447 |
| comA | Streptococcus mitis SK321 |
48.78 |
87.234 |
0.426 |
| comA | Streptococcus gordonii str. Challis substr. CH1 |
43.902 |
87.234 |
0.383 |