Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   HX0037_RS16925 Genome accession   NZ_CP139782
Coordinates   3416235..3416630 (+) Length   131 a.a.
NCBI ID   WP_094247733.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain HX0037     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3411235..3421630
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HX0037_RS16895 - 3411947..3412897 (+) 951 WP_071391609.1 magnesium transporter CorA family protein -
  HX0037_RS16900 comGA 3413089..3414159 (+) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  HX0037_RS16905 comGB 3414146..3415183 (+) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  HX0037_RS16910 comGC 3415188..3415496 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  HX0037_RS16915 comGD 3415486..3415923 (+) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  HX0037_RS16920 comGE 3415907..3416221 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  HX0037_RS16925 comGF 3416235..3416630 (+) 396 WP_094247733.1 competence type IV pilus minor pilin ComGF Machinery gene
  HX0037_RS16930 comGG 3416631..3417008 (+) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  HX0037_RS16935 - 3417065..3417244 (+) 180 WP_003153093.1 YqzE family protein -
  HX0037_RS16940 - 3417284..3417613 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  HX0037_RS16945 tapA 3417872..3418543 (+) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  HX0037_RS16950 sipW 3418515..3419099 (+) 585 WP_012117977.1 signal peptidase I SipW -
  HX0037_RS16955 tasA 3419163..3419948 (+) 786 WP_094247735.1 biofilm matrix protein TasA -
  HX0037_RS16960 sinR 3419996..3420331 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HX0037_RS16965 sinI 3420365..3420538 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  HX0037_RS16970 - 3420715..3421509 (-) 795 WP_014305407.1 YqhG family protein -

Sequence


Protein


Download         Length: 131 a.a.        Molecular weight: 14198.39 Da        Isoelectric Point: 8.7450

>NTDB_id=831453 HX0037_RS16925 WP_094247733.1 3416235..3416630(+) (comGF) [Bacillus amyloliquefaciens strain HX0037]
MAVCLFLSGTLGPILHLFLSNRTDNGGLDSREHQIAVQQIMNECKQAETVKPADGGRALACRETGGEEVRFEIYHKMIRK
RVNGKGHVPILQNAASLTADVKNGLLLLEISSVTGKKNQAVIPVYSSLKGD

Nucleotide


Download         Length: 396 bp        

>NTDB_id=831453 HX0037_RS16925 WP_094247733.1 3416235..3416630(+) (comGF) [Bacillus amyloliquefaciens strain HX0037]
TTGGCAGTCTGTCTTTTCCTATCAGGCACCCTGGGCCCGATTTTACATCTGTTTTTATCAAACCGGACCGATAACGGCGG
ATTAGACAGCCGGGAGCATCAAATTGCCGTTCAGCAGATCATGAACGAATGTAAACAGGCTGAGACTGTGAAGCCGGCGG
ACGGCGGACGGGCGTTAGCATGCCGGGAAACAGGAGGCGAAGAAGTGCGTTTTGAAATTTATCATAAGATGATAAGGAAA
AGAGTAAACGGAAAAGGCCACGTGCCGATCCTGCAAAACGCGGCATCATTAACGGCTGATGTGAAAAACGGCCTGCTCTT
ATTAGAGATCTCAAGCGTTACAGGTAAAAAGAATCAGGCGGTCATTCCGGTTTACAGCTCTTTAAAAGGTGATTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

47.619

96.183

0.458