Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   QAP01_RS07120 Genome accession   NZ_CP122950
Coordinates   1497958..1498071 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain BS28-1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1492958..1503071
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QAP01_RS07100 (QAP01_07100) - 1493639..1495051 (-) 1413 WP_286498179.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  QAP01_RS07105 (QAP01_07105) comB10 1495121..1496257 (-) 1137 WP_286498180.1 DNA type IV secretion system protein ComB10 Machinery gene
  QAP01_RS07110 (QAP01_07110) comB9 1496250..1497218 (-) 969 WP_286498181.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  QAP01_RS07115 (QAP01_07115) comB8 1497218..1497961 (-) 744 WP_001208392.1 virB8 family protein Machinery gene
  QAP01_RS07120 (QAP01_07120) comB7 1497958..1498071 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  QAP01_RS07125 (QAP01_07125) comB6 1498087..1499142 (-) 1056 WP_286498805.1 P-type conjugative transfer protein TrbL Machinery gene
  QAP01_RS07130 (QAP01_07130) - 1499150..1500145 (-) 996 WP_286498182.1 PDZ domain-containing protein -
  QAP01_RS07135 (QAP01_07135) - 1500145..1500447 (-) 303 WP_000347928.1 YbaB/EbfC family nucleoid-associated protein -
  QAP01_RS07140 (QAP01_07140) panD 1500450..1500803 (-) 354 WP_100950247.1 aspartate 1-decarboxylase -
  QAP01_RS07145 (QAP01_07145) - 1500793..1503018 (-) 2226 WP_286498183.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=817366 QAP01_RS07120 WP_001217873.1 1497958..1498071(-) (comB7) [Helicobacter pylori strain BS28-1]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=817366 QAP01_RS07120 WP_001217873.1 1497958..1498071(-) (comB7) [Helicobacter pylori strain BS28-1]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1