Detailed information    

experimental Experimentally validated

Overview


Name   comB7   Type   Machinery gene
Locus tag   - Genome accession   AJ132366
Coordinates   587..700 (+) Length   37 a.a.
NCBI ID   CAA10654.1    Uniprot ID   -
Organism   Helicobacter pylori P1     
Function   transformation-associated type IV transport system   
DNA binding and uptake

Function


By complementation of a Hp DeltacomB deletion mutant, we demonstrate that each of the proteins from ComB8 to ComB10 is absolutely essential for the development of natural transformation competence. The putative lipoprotein ComB7 is not essential, but apparently stabilizes the apparatus and modulates the transformation efficiency.


Genomic Context


Location: 1..5700
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Locus_0 comB6 1..571 (+) 571 CAA10653.1 hypothetical protein Machinery gene
  Locus_1 comB7 587..700 (+) 114 CAA10654.1 hypothetical protein Machinery gene
  Locus_2 comB8 697..1440 (+) 744 CAA10655.1 ComB1 protein Machinery gene
  Locus_3 comB9 1440..2420 (+) 981 CAA10656.1 ComB2 protein Machinery gene
  Locus_4 comB10 2413..3543 (+) 1131 CAA10657.1 ComB3 protein Machinery gene
  Locus_5 algA 3613..3962 (+) 350 CAA10658.1 mannose 6 phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=1215 CAA10654.1 587..700(+) (comB7) [Helicobacter pylori P1]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA*

Nucleotide


Download         Length: 114 bp        

>NTDB_id=1215 CAA10654.1 587..700(+) (comB7) [Helicobacter pylori P1]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Christopher Corbinais et al. (2017) ComB proteins expression levels determine Helicobacter pylori competence capacity. Scientific Reports 7:41495. [PMID: 28128333]
[2] Dirk Hofreuter et al. (2003) Topology and membrane interaction of Helicobacter pylori ComB proteins involved in natural transformation competence. International Journal of Medical Microbiology : IJMM 293(2-3):153-65. [PMID: 12868652]
[3] D Hofreuter et al. (2001) Natural transformation competence in Helicobacter pylori is mediated by the basic components of a type IV secretion system. Molecular Microbiology 41(2):379-91. [PMID: 11489125]
[4] D Hofreuter et al. (1998) Natural competence for DNA transformation in Helicobacter pylori: identification and genetic characterization of the comB locus. Molecular Microbiology 28(5):1027-38. [PMID: 9663688]