Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   QA442_RS09360 Genome accession   NZ_CP121861
Coordinates   1789113..1789493 (+) Length   126 a.a.
NCBI ID   WP_095431684.1    Uniprot ID   -
Organism   Bacillus stercoris strain Mal05     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1784113..1794493
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QA442_RS09325 (QA442_09325) corA 1784290..1785243 (+) 954 WP_279474190.1 magnesium transporter CorA -
  QA442_RS09330 (QA442_09330) - 1785306..1785724 (+) 419 Protein_1802 CBS domain-containing protein -
  QA442_RS09335 (QA442_09335) comGA 1785937..1787007 (+) 1071 WP_095431688.1 competence protein ComGA Machinery gene
  QA442_RS09340 (QA442_09340) comGB 1786994..1788031 (+) 1038 WP_095431687.1 competence type IV pilus assembly protein ComGB Machinery gene
  QA442_RS09345 (QA442_09345) comGC 1788045..1788341 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  QA442_RS09350 (QA442_09350) comGD 1788331..1788762 (+) 432 WP_095431686.1 competence type IV pilus minor pilin ComGD Machinery gene
  QA442_RS09355 (QA442_09355) comGE 1788746..1789087 (+) 342 WP_095431685.1 competence type IV pilus minor pilin ComGE Machinery gene
  QA442_RS09360 (QA442_09360) comGF 1789113..1789493 (+) 381 WP_095431684.1 competence type IV pilus minor pilin ComGF Machinery gene
  QA442_RS09365 (QA442_09365) comGG 1789494..1789868 (+) 375 WP_040082643.1 competence type IV pilus minor pilin ComGG Machinery gene
  QA442_RS09370 (QA442_09370) - 1789940..1790119 (+) 180 WP_014480252.1 YqzE family protein -
  QA442_RS09375 (QA442_09375) - 1790160..1790486 (-) 327 WP_014664589.1 YqzG/YhdC family protein -
  QA442_RS09380 (QA442_09380) tapA 1790758..1791513 (+) 756 WP_095431683.1 amyloid fiber anchoring/assembly protein TapA -
  QA442_RS09385 (QA442_09385) - 1791497..1792069 (+) 573 WP_014664587.1 signal peptidase I -
  QA442_RS09390 (QA442_09390) tasA 1792133..1792918 (+) 786 WP_095431682.1 biofilm matrix protein TasA -
  QA442_RS09395 (QA442_09395) sinR 1793011..1793346 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QA442_RS09400 (QA442_09400) sinI 1793380..1793553 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator

Sequence

Protein


Download         Length: 126 a.a.        Molecular weight: 14260.40 Da        Isoelectric Point: 6.4842

>NTDB_id=814906 QA442_RS09360 WP_095431684.1 1789113..1789493(+) (comGF) [Bacillus stercoris strain Mal05]
MLISGSLATIFHLFLSRQQDHDGFTQQEWMISIEQMMNECKESQAVKTVEHGSVLICTNLSGQDIRFEVYHSMVRKRVDG
KGHVPILDHITAMKADIENGIVLLKIESEKKVYQTSFPVYSYLGGG

Nucleotide


Download         Length: 381 bp        

>NTDB_id=814906 QA442_RS09360 WP_095431684.1 1789113..1789493(+) (comGF) [Bacillus stercoris strain Mal05]
TTGCTCATATCAGGATCGTTAGCGACGATTTTCCATTTGTTTTTATCTCGACAGCAGGATCATGACGGTTTTACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGTCGAGCATGGGAGCG
TTTTAATTTGCACCAACCTTTCCGGGCAAGACATCCGTTTTGAAGTTTATCATTCTATGGTAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCCATTTTAGATCATATTACAGCTATGAAAGCTGATATTGAAAATGGTATTGTTTTGCTGAAAATTGA
GAGTGAGAAAAAAGTGTATCAAACTTCTTTTCCGGTTTATTCGTATTTAGGAGGAGGGTGA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(16-110)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

91.339

100

0.921