Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QA442_RS09400 Genome accession   NZ_CP121861
Coordinates   1793380..1793553 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus stercoris strain Mal05     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1788380..1798553
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QA442_RS09355 (QA442_09355) comGE 1788746..1789087 (+) 342 WP_095431685.1 competence type IV pilus minor pilin ComGE Machinery gene
  QA442_RS09360 (QA442_09360) comGF 1789113..1789493 (+) 381 WP_095431684.1 competence type IV pilus minor pilin ComGF Machinery gene
  QA442_RS09365 (QA442_09365) comGG 1789494..1789868 (+) 375 WP_040082643.1 competence type IV pilus minor pilin ComGG Machinery gene
  QA442_RS09370 (QA442_09370) - 1789940..1790119 (+) 180 WP_014480252.1 YqzE family protein -
  QA442_RS09375 (QA442_09375) - 1790160..1790486 (-) 327 WP_014664589.1 YqzG/YhdC family protein -
  QA442_RS09380 (QA442_09380) tapA 1790758..1791513 (+) 756 WP_095431683.1 amyloid fiber anchoring/assembly protein TapA -
  QA442_RS09385 (QA442_09385) - 1791497..1792069 (+) 573 WP_014664587.1 signal peptidase I -
  QA442_RS09390 (QA442_09390) tasA 1792133..1792918 (+) 786 WP_095431682.1 biofilm matrix protein TasA -
  QA442_RS09395 (QA442_09395) sinR 1793011..1793346 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QA442_RS09400 (QA442_09400) sinI 1793380..1793553 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  QA442_RS09405 (QA442_09405) - 1793737..1794531 (-) 795 WP_095431681.1 YqhG family protein -
  QA442_RS09410 (QA442_09410) - 1794552..1796225 (-) 1674 WP_069149860.1 SNF2-related protein -
  QA442_RS09415 (QA442_09415) gcvT 1796667..1797755 (+) 1089 WP_279474201.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=814909 QA442_RS09400 WP_003230187.1 1793380..1793553(-) (sinI) [Bacillus stercoris strain Mal05]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=814909 QA442_RS09400 WP_003230187.1 1793380..1793553(-) (sinI) [Bacillus stercoris strain Mal05]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1