Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   PM3_RS01675 Genome accession   NZ_CP121788
Coordinates   332380..332814 (-) Length   144 a.a.
NCBI ID   WP_135961506.1    Uniprot ID   -
Organism   Pasteurella multocida strain PM-3     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 284856..335729 332380..332814 within 0


Gene organization within MGE regions


Location: 284856..335729
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PM3_RS01380 (PM3_0259) mobH 285194..287128 (-) 1935 WP_135961545.1 MobH family relaxase -
  PM3_RS01385 (PM3_0260) - 287226..287813 (-) 588 WP_135961544.1 recombinase family protein -
  PM3_RS01390 (PM3_0261) - 288069..288215 (+) 147 WP_168341803.1 hypothetical protein -
  PM3_RS01395 (PM3_0262) - 288219..288491 (-) 273 WP_135961543.1 hypothetical protein -
  PM3_RS01400 (PM3_0263) - 288598..288732 (-) 135 WP_267912080.1 hypothetical protein -
  PM3_RS11215 - 289318..289533 (+) 216 WP_024434389.1 phosphoglucosamine mutase -
  PM3_RS01405 (PM3_0265) - 289553..289960 (+) 408 WP_219848224.1 mobilization domain protein -
  PM3_RS01410 (PM3_0267) - 290195..290416 (-) 222 WP_001251694.1 hypothetical protein -
  PM3_RS01415 (PM3_0268) - 290407..290610 (-) 204 WP_000131876.1 hypothetical protein -
  PM3_RS01420 (PM3_0269) sul2 290947..291762 (+) 816 WP_001043260.1 sulfonamide-resistant dihydropteroate synthase Sul2 -
  PM3_RS01430 (PM3_0271) - 292126..293097 (-) 972 WP_135961541.1 zincin-like metallopeptidase domain-containing protein -
  PM3_RS01435 (PM3_0272) - 293179..294063 (-) 885 WP_135961540.1 hypothetical protein -
  PM3_RS01440 (PM3_0273) - 294140..294322 (-) 183 WP_233784708.1 hypothetical protein -
  PM3_RS01445 (PM3_0274) - 294470..294823 (-) 354 WP_135961538.1 hypothetical protein -
  PM3_RS01450 (PM3_0275) - 295214..295666 (+) 453 WP_135961537.1 TIGR03757 family integrating conjugative element protein -
  PM3_RS01455 (PM3_0276) - 295666..296604 (+) 939 WP_135961536.1 TIGR03756 family integrating conjugative element protein -
  PM3_RS01460 (PM3_0277) - 296620..298620 (+) 2001 WP_217883985.1 integrating conjugative element protein -
  PM3_RS01465 (PM3_0278) - 298643..299056 (+) 414 WP_135961535.1 hypothetical protein -
  PM3_RS01470 (PM3_0279) - 299209..299577 (+) 369 WP_135961534.1 hypothetical protein -
  PM3_RS01475 (PM3_0280) - 299612..301123 (-) 1512 WP_135961533.1 conjugal transfer protein TraG N-terminal domain-containing protein -
  PM3_RS01480 (PM3_0281) - 301141..301467 (-) 327 WP_135961532.1 hypothetical protein -
  PM3_RS01485 (PM3_0282) - 301454..301894 (-) 441 WP_135961531.1 hypothetical protein -
  PM3_RS01490 (PM3_0283) - 301891..304692 (-) 2802 WP_217883986.1 conjugative transfer ATPase -
  PM3_RS01495 (PM3_0284) - 304695..305090 (-) 396 WP_135961529.1 TIGR03751 family conjugal transfer lipoprotein -
  PM3_RS01500 (PM3_0285) - 305101..306540 (-) 1440 WP_135961528.1 TIGR03752 family integrating conjugative element protein -
  PM3_RS01505 (PM3_0286) - 306549..307439 (-) 891 WP_135961527.1 TIGR03749 family integrating conjugative element protein -
  PM3_RS01510 (PM3_0287) - 307439..308080 (-) 642 WP_135961526.1 PFL_4703 family integrating conjugative element protein -
  PM3_RS01515 (PM3_0288) - 308077..308448 (-) 372 WP_135961525.1 TIGR03750 family conjugal transfer protein -
  PM3_RS01520 (PM3_0289) - 308478..308897 (-) 420 WP_135961524.1 DUF2976 domain-containing protein -
  PM3_RS01525 (PM3_0290) - 308918..309169 (-) 252 WP_135961523.1 DUF3262 family protein -
  PM3_RS01530 (PM3_0291) - 309169..309495 (-) 327 WP_217883987.1 RAQPRD family integrative conjugative element protein -
  PM3_RS01535 (PM3_0292) - 309695..310027 (+) 333 WP_135961521.1 hypothetical protein -
  PM3_RS01540 (PM3_0293) - 310083..310784 (-) 702 WP_135961520.1 TIGR03747 family integrating conjugative element membrane protein -
  PM3_RS01545 (PM3_0294) - 310781..311134 (-) 354 WP_135961519.1 hemophilus-specific protein -
  PM3_RS01550 (PM3_0295) traD 311121..313337 (-) 2217 WP_135961518.1 type IV conjugative transfer system coupling protein TraD -
  PM3_RS01555 (PM3_0296) - 313337..313840 (-) 504 WP_135961517.1 integrating conjugative element protein -
  PM3_RS01560 (PM3_0297) - 313852..314607 (-) 756 WP_233784721.1 hypothetical protein -
  PM3_RS01565 (PM3_0298) - 314631..315365 (-) 735 WP_217883988.1 TIGR03759 family integrating conjugative element protein -
  PM3_RS01570 (PM3_0299) - 315365..316003 (-) 639 WP_135961515.1 hypothetical protein -
  PM3_RS01575 (PM3_0300) - 316217..317485 (-) 1269 Protein_292 Tn3-like element Tn3 family transposase -
  PM3_RS01580 (PM3_0301) - 317553..318257 (+) 705 WP_001067858.1 IS6-like element IS26 family transposase -
  PM3_RS01585 (PM3_0302) bleO 318451..318837 (+) 387 WP_063102497.1 bleomycin binding protein -
  PM3_RS01590 (PM3_0303) - 319157..319549 (-) 393 WP_000084744.1 pyridoxamine 5'-phosphate oxidase family protein -
  PM3_RS01595 - 319785..320489 (-) 705 WP_001067858.1 IS6-like element IS26 family transposase -
  PM3_RS01600 (PM3_0306) - 320675..320995 (+) 321 WP_000562370.1 antibiotic biosynthesis monooxygenase -
  PM3_RS01605 (PM3_0307) - 320988..321374 (+) 387 WP_135961514.1 amino acid-binding protein -
  PM3_RS01610 - 321382..322068 (+) 687 WP_001284954.1 winged helix-turn-helix domain-containing protein -
  PM3_RS01615 (PM3_0308) tetR(B) 322046..322669 (-) 624 WP_000088605.1 tetracycline resistance transcriptional repressor TetR(B) -
  PM3_RS01620 (PM3_0309) tet(B) 322751..323956 (+) 1206 WP_001089068.1 tetracycline efflux MFS transporter Tet(B) -
  PM3_RS01625 (PM3_0310) tetC 324069..324662 (-) 594 WP_000428546.1 tetracyline resistance-associated transcriptional repressor TetC -
  PM3_RS01630 (PM3_0311) - 324750..325166 (+) 417 WP_000275180.1 helix-turn-helix domain-containing protein -
  PM3_RS01635 (PM3_0312) - 325176..326384 (-) 1209 WP_006250222.1 IS4-like element ISVsa5 family transposase -
  PM3_RS01640 (PM3_0313) - 326324..326842 (-) 519 WP_135961513.1 DUF3560 domain-containing protein -
  PM3_RS01645 (PM3_0314) - 326926..327255 (-) 330 WP_135961512.1 hypothetical protein -
  PM3_RS01650 (PM3_0315) - 327365..327814 (-) 450 WP_135961511.1 STY4534 family ICE replication protein -
  PM3_RS01655 (PM3_0316) - 328627..330663 (-) 2037 WP_135961510.1 DNA topoisomerase III -
  PM3_RS01660 (PM3_0317) - 330821..331315 (-) 495 WP_135961509.1 hemophilus-specific protein -
  PM3_RS01665 (PM3_0318) - 331410..332057 (+) 648 WP_135961508.1 hypothetical protein -
  PM3_RS01670 - 332008..332307 (-) 300 WP_135961507.1 hypothetical protein -
  PM3_RS01675 (PM3_0319) ssb 332380..332814 (-) 435 WP_135961506.1 single-stranded DNA-binding protein Machinery gene
  PM3_RS01680 (PM3_0320) - 333064..333531 (-) 468 WP_135961505.1 DUF3158 family protein -
  PM3_RS01685 (PM3_0321) - 333540..334298 (-) 759 WP_135961504.1 PFL_4669 family integrating conjugative element protein -
  PM3_RS01690 (PM3_0322) - 334488..335690 (-) 1203 WP_135961503.1 STY4528 family pathogenicity island replication protein -

Sequence


Protein


Download         Length: 144 a.a.        Molecular weight: 16341.19 Da        Isoelectric Point: 6.2357

>NTDB_id=814191 PM3_RS01675 WP_135961506.1 332380..332814(-) (ssb) [Pasteurella multocida strain PM-3]
MAGINKVIIVGHLGNEPELRTMPNGEVIANISVATSESWTDKTTGERREVTEWHRIVFYRRQAEVVGQYLHKGSQIYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLGGRNNGTYPAPTQNQPANVSNQMEPPINNFDGDIPF

Nucleotide


Download         Length: 435 bp        

>NTDB_id=814191 PM3_RS01675 WP_135961506.1 332380..332814(-) (ssb) [Pasteurella multocida strain PM-3]
ATGGCAGGCATCAATAAAGTCATTATTGTCGGGCATCTTGGTAATGAACCTGAATTGCGTACTATGCCAAATGGCGAAGT
AATTGCAAATATCAGTGTTGCAACAAGTGAAAGCTGGACGGATAAAACAACAGGAGAACGTCGTGAAGTAACTGAATGGC
ACCGCATTGTGTTTTATCGTCGTCAAGCTGAAGTGGTCGGTCAGTACCTTCATAAAGGTTCACAGATTTATGTAGAAGGT
CGTTTACGTACCCGCAAATGGCAAGATCAAAATGGTCAAGACCGTTATACCACGGAAATTCAAGGCGATGTATTACAAAT
GTTAGGTGGGCGTAATAATGGAACATACCCTGCTCCAACACAAAATCAACCTGCTAATGTATCGAATCAAATGGAGCCTC
CGATAAATAACTTTGATGGCGACATTCCGTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

58.152

100

0.743

  ssb Vibrio cholerae strain A1552

50.575

100

0.611

  ssb Neisseria gonorrhoeae MS11

41.04

100

0.493

  ssb Neisseria meningitidis MC58

41.04

100

0.493

  ssb Latilactobacillus sakei subsp. sakei 23K

30.233

100

0.361