Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PM3_RS01675 | Genome accession | NZ_CP121788 |
| Coordinates | 332380..332814 (-) | Length | 144 a.a. |
| NCBI ID | WP_135961506.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain PM-3 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 284856..335729 | 332380..332814 | within | 0 |
Gene organization within MGE regions
Location: 284856..335729
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PM3_RS01380 (PM3_0259) | mobH | 285194..287128 (-) | 1935 | WP_135961545.1 | MobH family relaxase | - |
| PM3_RS01385 (PM3_0260) | - | 287226..287813 (-) | 588 | WP_135961544.1 | recombinase family protein | - |
| PM3_RS01390 (PM3_0261) | - | 288069..288215 (+) | 147 | WP_168341803.1 | hypothetical protein | - |
| PM3_RS01395 (PM3_0262) | - | 288219..288491 (-) | 273 | WP_135961543.1 | hypothetical protein | - |
| PM3_RS01400 (PM3_0263) | - | 288598..288732 (-) | 135 | WP_267912080.1 | hypothetical protein | - |
| PM3_RS11215 | - | 289318..289533 (+) | 216 | WP_024434389.1 | phosphoglucosamine mutase | - |
| PM3_RS01405 (PM3_0265) | - | 289553..289960 (+) | 408 | WP_219848224.1 | mobilization domain protein | - |
| PM3_RS01410 (PM3_0267) | - | 290195..290416 (-) | 222 | WP_001251694.1 | hypothetical protein | - |
| PM3_RS01415 (PM3_0268) | - | 290407..290610 (-) | 204 | WP_000131876.1 | hypothetical protein | - |
| PM3_RS01420 (PM3_0269) | sul2 | 290947..291762 (+) | 816 | WP_001043260.1 | sulfonamide-resistant dihydropteroate synthase Sul2 | - |
| PM3_RS01430 (PM3_0271) | - | 292126..293097 (-) | 972 | WP_135961541.1 | zincin-like metallopeptidase domain-containing protein | - |
| PM3_RS01435 (PM3_0272) | - | 293179..294063 (-) | 885 | WP_135961540.1 | hypothetical protein | - |
| PM3_RS01440 (PM3_0273) | - | 294140..294322 (-) | 183 | WP_233784708.1 | hypothetical protein | - |
| PM3_RS01445 (PM3_0274) | - | 294470..294823 (-) | 354 | WP_135961538.1 | hypothetical protein | - |
| PM3_RS01450 (PM3_0275) | - | 295214..295666 (+) | 453 | WP_135961537.1 | TIGR03757 family integrating conjugative element protein | - |
| PM3_RS01455 (PM3_0276) | - | 295666..296604 (+) | 939 | WP_135961536.1 | TIGR03756 family integrating conjugative element protein | - |
| PM3_RS01460 (PM3_0277) | - | 296620..298620 (+) | 2001 | WP_217883985.1 | integrating conjugative element protein | - |
| PM3_RS01465 (PM3_0278) | - | 298643..299056 (+) | 414 | WP_135961535.1 | hypothetical protein | - |
| PM3_RS01470 (PM3_0279) | - | 299209..299577 (+) | 369 | WP_135961534.1 | hypothetical protein | - |
| PM3_RS01475 (PM3_0280) | - | 299612..301123 (-) | 1512 | WP_135961533.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| PM3_RS01480 (PM3_0281) | - | 301141..301467 (-) | 327 | WP_135961532.1 | hypothetical protein | - |
| PM3_RS01485 (PM3_0282) | - | 301454..301894 (-) | 441 | WP_135961531.1 | hypothetical protein | - |
| PM3_RS01490 (PM3_0283) | - | 301891..304692 (-) | 2802 | WP_217883986.1 | conjugative transfer ATPase | - |
| PM3_RS01495 (PM3_0284) | - | 304695..305090 (-) | 396 | WP_135961529.1 | TIGR03751 family conjugal transfer lipoprotein | - |
| PM3_RS01500 (PM3_0285) | - | 305101..306540 (-) | 1440 | WP_135961528.1 | TIGR03752 family integrating conjugative element protein | - |
| PM3_RS01505 (PM3_0286) | - | 306549..307439 (-) | 891 | WP_135961527.1 | TIGR03749 family integrating conjugative element protein | - |
| PM3_RS01510 (PM3_0287) | - | 307439..308080 (-) | 642 | WP_135961526.1 | PFL_4703 family integrating conjugative element protein | - |
| PM3_RS01515 (PM3_0288) | - | 308077..308448 (-) | 372 | WP_135961525.1 | TIGR03750 family conjugal transfer protein | - |
| PM3_RS01520 (PM3_0289) | - | 308478..308897 (-) | 420 | WP_135961524.1 | DUF2976 domain-containing protein | - |
| PM3_RS01525 (PM3_0290) | - | 308918..309169 (-) | 252 | WP_135961523.1 | DUF3262 family protein | - |
| PM3_RS01530 (PM3_0291) | - | 309169..309495 (-) | 327 | WP_217883987.1 | RAQPRD family integrative conjugative element protein | - |
| PM3_RS01535 (PM3_0292) | - | 309695..310027 (+) | 333 | WP_135961521.1 | hypothetical protein | - |
| PM3_RS01540 (PM3_0293) | - | 310083..310784 (-) | 702 | WP_135961520.1 | TIGR03747 family integrating conjugative element membrane protein | - |
| PM3_RS01545 (PM3_0294) | - | 310781..311134 (-) | 354 | WP_135961519.1 | hemophilus-specific protein | - |
| PM3_RS01550 (PM3_0295) | traD | 311121..313337 (-) | 2217 | WP_135961518.1 | type IV conjugative transfer system coupling protein TraD | - |
| PM3_RS01555 (PM3_0296) | - | 313337..313840 (-) | 504 | WP_135961517.1 | integrating conjugative element protein | - |
| PM3_RS01560 (PM3_0297) | - | 313852..314607 (-) | 756 | WP_233784721.1 | hypothetical protein | - |
| PM3_RS01565 (PM3_0298) | - | 314631..315365 (-) | 735 | WP_217883988.1 | TIGR03759 family integrating conjugative element protein | - |
| PM3_RS01570 (PM3_0299) | - | 315365..316003 (-) | 639 | WP_135961515.1 | hypothetical protein | - |
| PM3_RS01575 (PM3_0300) | - | 316217..317485 (-) | 1269 | Protein_292 | Tn3-like element Tn3 family transposase | - |
| PM3_RS01580 (PM3_0301) | - | 317553..318257 (+) | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
| PM3_RS01585 (PM3_0302) | bleO | 318451..318837 (+) | 387 | WP_063102497.1 | bleomycin binding protein | - |
| PM3_RS01590 (PM3_0303) | - | 319157..319549 (-) | 393 | WP_000084744.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| PM3_RS01595 | - | 319785..320489 (-) | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
| PM3_RS01600 (PM3_0306) | - | 320675..320995 (+) | 321 | WP_000562370.1 | antibiotic biosynthesis monooxygenase | - |
| PM3_RS01605 (PM3_0307) | - | 320988..321374 (+) | 387 | WP_135961514.1 | amino acid-binding protein | - |
| PM3_RS01610 | - | 321382..322068 (+) | 687 | WP_001284954.1 | winged helix-turn-helix domain-containing protein | - |
| PM3_RS01615 (PM3_0308) | tetR(B) | 322046..322669 (-) | 624 | WP_000088605.1 | tetracycline resistance transcriptional repressor TetR(B) | - |
| PM3_RS01620 (PM3_0309) | tet(B) | 322751..323956 (+) | 1206 | WP_001089068.1 | tetracycline efflux MFS transporter Tet(B) | - |
| PM3_RS01625 (PM3_0310) | tetC | 324069..324662 (-) | 594 | WP_000428546.1 | tetracyline resistance-associated transcriptional repressor TetC | - |
| PM3_RS01630 (PM3_0311) | - | 324750..325166 (+) | 417 | WP_000275180.1 | helix-turn-helix domain-containing protein | - |
| PM3_RS01635 (PM3_0312) | - | 325176..326384 (-) | 1209 | WP_006250222.1 | IS4-like element ISVsa5 family transposase | - |
| PM3_RS01640 (PM3_0313) | - | 326324..326842 (-) | 519 | WP_135961513.1 | DUF3560 domain-containing protein | - |
| PM3_RS01645 (PM3_0314) | - | 326926..327255 (-) | 330 | WP_135961512.1 | hypothetical protein | - |
| PM3_RS01650 (PM3_0315) | - | 327365..327814 (-) | 450 | WP_135961511.1 | STY4534 family ICE replication protein | - |
| PM3_RS01655 (PM3_0316) | - | 328627..330663 (-) | 2037 | WP_135961510.1 | DNA topoisomerase III | - |
| PM3_RS01660 (PM3_0317) | - | 330821..331315 (-) | 495 | WP_135961509.1 | hemophilus-specific protein | - |
| PM3_RS01665 (PM3_0318) | - | 331410..332057 (+) | 648 | WP_135961508.1 | hypothetical protein | - |
| PM3_RS01670 | - | 332008..332307 (-) | 300 | WP_135961507.1 | hypothetical protein | - |
| PM3_RS01675 (PM3_0319) | ssb | 332380..332814 (-) | 435 | WP_135961506.1 | single-stranded DNA-binding protein | Machinery gene |
| PM3_RS01680 (PM3_0320) | - | 333064..333531 (-) | 468 | WP_135961505.1 | DUF3158 family protein | - |
| PM3_RS01685 (PM3_0321) | - | 333540..334298 (-) | 759 | WP_135961504.1 | PFL_4669 family integrating conjugative element protein | - |
| PM3_RS01690 (PM3_0322) | - | 334488..335690 (-) | 1203 | WP_135961503.1 | STY4528 family pathogenicity island replication protein | - |
Sequence
Protein
Download Length: 144 a.a. Molecular weight: 16341.19 Da Isoelectric Point: 6.2357
>NTDB_id=814191 PM3_RS01675 WP_135961506.1 332380..332814(-) (ssb) [Pasteurella multocida strain PM-3]
MAGINKVIIVGHLGNEPELRTMPNGEVIANISVATSESWTDKTTGERREVTEWHRIVFYRRQAEVVGQYLHKGSQIYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLGGRNNGTYPAPTQNQPANVSNQMEPPINNFDGDIPF
MAGINKVIIVGHLGNEPELRTMPNGEVIANISVATSESWTDKTTGERREVTEWHRIVFYRRQAEVVGQYLHKGSQIYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLGGRNNGTYPAPTQNQPANVSNQMEPPINNFDGDIPF
Nucleotide
Download Length: 435 bp
>NTDB_id=814191 PM3_RS01675 WP_135961506.1 332380..332814(-) (ssb) [Pasteurella multocida strain PM-3]
ATGGCAGGCATCAATAAAGTCATTATTGTCGGGCATCTTGGTAATGAACCTGAATTGCGTACTATGCCAAATGGCGAAGT
AATTGCAAATATCAGTGTTGCAACAAGTGAAAGCTGGACGGATAAAACAACAGGAGAACGTCGTGAAGTAACTGAATGGC
ACCGCATTGTGTTTTATCGTCGTCAAGCTGAAGTGGTCGGTCAGTACCTTCATAAAGGTTCACAGATTTATGTAGAAGGT
CGTTTACGTACCCGCAAATGGCAAGATCAAAATGGTCAAGACCGTTATACCACGGAAATTCAAGGCGATGTATTACAAAT
GTTAGGTGGGCGTAATAATGGAACATACCCTGCTCCAACACAAAATCAACCTGCTAATGTATCGAATCAAATGGAGCCTC
CGATAAATAACTTTGATGGCGACATTCCGTTCTGA
ATGGCAGGCATCAATAAAGTCATTATTGTCGGGCATCTTGGTAATGAACCTGAATTGCGTACTATGCCAAATGGCGAAGT
AATTGCAAATATCAGTGTTGCAACAAGTGAAAGCTGGACGGATAAAACAACAGGAGAACGTCGTGAAGTAACTGAATGGC
ACCGCATTGTGTTTTATCGTCGTCAAGCTGAAGTGGTCGGTCAGTACCTTCATAAAGGTTCACAGATTTATGTAGAAGGT
CGTTTACGTACCCGCAAATGGCAAGATCAAAATGGTCAAGACCGTTATACCACGGAAATTCAAGGCGATGTATTACAAAT
GTTAGGTGGGCGTAATAATGGAACATACCCTGCTCCAACACAAAATCAACCTGCTAATGTATCGAATCAAATGGAGCCTC
CGATAAATAACTTTGATGGCGACATTCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
58.152 |
100 |
0.743 |
| ssb | Vibrio cholerae strain A1552 |
50.575 |
100 |
0.611 |
| ssb | Neisseria gonorrhoeae MS11 |
41.04 |
100 |
0.493 |
| ssb | Neisseria meningitidis MC58 |
41.04 |
100 |
0.493 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
30.233 |
100 |
0.361 |