Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | P7F77_RS10660 | Genome accession | NZ_CP121204 |
| Coordinates | 2130642..2131061 (-) | Length | 139 a.a. |
| NCBI ID | WP_278043633.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain SA0907 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2097654..2140691 | 2130642..2131061 | within | 0 |
Gene organization within MGE regions
Location: 2097654..2140691
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7F77_RS10400 (P7F77_10405) | scn | 2097654..2098004 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| P7F77_RS10405 (P7F77_10410) | - | 2098689..2099138 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| P7F77_RS10410 (P7F77_10415) | - | 2099233..2099568 (-) | 336 | Protein_2014 | SH3 domain-containing protein | - |
| P7F77_RS10415 (P7F77_10420) | sak | 2100218..2100709 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| P7F77_RS10420 (P7F77_10425) | - | 2100900..2101655 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| P7F77_RS10425 (P7F77_10430) | - | 2101667..2101921 (-) | 255 | WP_000611512.1 | phage holin | - |
| P7F77_RS10430 (P7F77_10435) | - | 2101973..2102080 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| P7F77_RS10435 (P7F77_10440) | pepG1 | 2102133..2102267 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| P7F77_RS10440 (P7F77_10445) | - | 2102459..2102755 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| P7F77_RS10445 (P7F77_10450) | - | 2102813..2103100 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| P7F77_RS10450 (P7F77_10455) | - | 2103147..2103299 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| P7F77_RS10455 (P7F77_10460) | - | 2103289..2107074 (-) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| P7F77_RS10460 (P7F77_10465) | - | 2107090..2108580 (-) | 1491 | WP_031880131.1 | phage tail domain-containing protein | - |
| P7F77_RS10465 (P7F77_10470) | - | 2108580..2113229 (-) | 4650 | WP_278043626.1 | phage tail tape measure protein | - |
| P7F77_RS10470 (P7F77_10475) | - | 2113285..2113407 (-) | 123 | WP_000571956.1 | hypothetical protein | - |
| P7F77_RS10475 (P7F77_10480) | - | 2113467..2113913 (-) | 447 | WP_000442604.1 | hypothetical protein | - |
| P7F77_RS10480 (P7F77_10485) | - | 2113979..2114932 (-) | 954 | WP_044132383.1 | major tail protein | - |
| P7F77_RS10485 (P7F77_10490) | - | 2114925..2115314 (-) | 390 | WP_044132385.1 | hypothetical protein | - |
| P7F77_RS10490 (P7F77_10495) | - | 2115311..2115688 (-) | 378 | WP_000501001.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| P7F77_RS10495 (P7F77_10500) | - | 2115688..2116020 (-) | 333 | WP_044132386.1 | head-tail adaptor protein | - |
| P7F77_RS10500 (P7F77_10505) | - | 2116010..2116342 (-) | 333 | WP_044132387.1 | head-tail connector protein | - |
| P7F77_RS10505 (P7F77_10510) | - | 2116351..2116509 (-) | 159 | WP_031902987.1 | hypothetical protein | - |
| P7F77_RS10510 (P7F77_10515) | - | 2116546..2117781 (-) | 1236 | WP_044132392.1 | phage major capsid protein | - |
| P7F77_RS10515 (P7F77_10520) | - | 2117869..2118453 (-) | 585 | WP_044132398.1 | HK97 family phage prohead protease | - |
| P7F77_RS10520 (P7F77_10525) | - | 2118428..2119702 (-) | 1275 | WP_044132404.1 | phage portal protein | - |
| P7F77_RS10525 (P7F77_10530) | - | 2119705..2119908 (-) | 204 | WP_044132409.1 | hypothetical protein | - |
| P7F77_RS10530 (P7F77_10535) | - | 2119922..2121616 (-) | 1695 | WP_278043627.1 | phage terminase family protein | - |
| P7F77_RS10535 (P7F77_10540) | - | 2121616..2122086 (-) | 471 | WP_044132419.1 | phage terminase small subunit P27 family | - |
| P7F77_RS10540 (P7F77_10545) | - | 2122215..2122559 (-) | 345 | WP_078103664.1 | HNH endonuclease | - |
| P7F77_RS10545 (P7F77_10550) | - | 2122575..2123027 (-) | 453 | WP_046594624.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| P7F77_RS10550 (P7F77_10555) | - | 2123142..2123603 (-) | 462 | WP_046594622.1 | hypothetical protein | - |
| P7F77_RS10555 (P7F77_10560) | - | 2123626..2123826 (-) | 201 | WP_046594621.1 | DUF1514 family protein | - |
| P7F77_RS10560 (P7F77_10565) | - | 2123826..2123960 (-) | 135 | WP_347403336.1 | hypothetical protein | - |
| P7F77_RS10565 (P7F77_10570) | - | 2123937..2124041 (-) | 105 | Protein_2045 | transcriptional regulator | - |
| P7F77_RS10570 (P7F77_10575) | - | 2124038..2124427 (-) | 390 | WP_024936909.1 | hypothetical protein | - |
| P7F77_RS10575 (P7F77_10580) | - | 2124417..2124653 (-) | 237 | WP_278043628.1 | hypothetical protein | - |
| P7F77_RS10580 (P7F77_10585) | - | 2124646..2124849 (-) | 204 | WP_001072794.1 | hypothetical protein | - |
| P7F77_RS10585 (P7F77_10590) | - | 2124846..2125040 (-) | 195 | WP_072532483.1 | DUF1381 domain-containing protein | - |
| P7F77_RS10590 (P7F77_10595) | - | 2125057..2125230 (-) | 174 | WP_001209216.1 | hypothetical protein | - |
| P7F77_RS10595 (P7F77_10600) | - | 2125267..2125803 (-) | 537 | WP_000185680.1 | dUTPase | - |
| P7F77_RS10600 (P7F77_10605) | - | 2125796..2126044 (-) | 249 | WP_278043629.1 | DUF1024 family protein | - |
| P7F77_RS10605 (P7F77_10610) | - | 2126058..2126300 (-) | 243 | WP_000131384.1 | SAV1978 family virulence-associated passenger protein | - |
| P7F77_RS10610 (P7F77_10615) | - | 2126304..2126918 (-) | 615 | WP_269725315.1 | SA1788 family PVL leukocidin-associated protein | - |
| P7F77_RS10615 (P7F77_10620) | - | 2126919..2127104 (-) | 186 | WP_001187266.1 | DUF3113 family protein | - |
| P7F77_RS10620 (P7F77_10625) | - | 2127109..2127513 (-) | 405 | WP_278043630.1 | DUF1064 domain-containing protein | - |
| P7F77_RS10625 (P7F77_10630) | - | 2127523..2127744 (-) | 222 | WP_001123695.1 | DUF3269 family protein | - |
| P7F77_RS10630 (P7F77_10635) | - | 2127757..2127915 (-) | 159 | WP_000256594.1 | hypothetical protein | - |
| P7F77_RS10635 (P7F77_10640) | - | 2127909..2128688 (-) | 780 | WP_000803062.1 | ATP-binding protein | - |
| P7F77_RS10640 (P7F77_10645) | - | 2128698..2129468 (-) | 771 | WP_000190254.1 | conserved phage C-terminal domain-containing protein | - |
| P7F77_RS10645 (P7F77_10650) | - | 2129534..2129815 (+) | 282 | WP_000414755.1 | hypothetical protein | - |
| P7F77_RS10650 (P7F77_10655) | - | 2129808..2129957 (-) | 150 | WP_001081076.1 | hypothetical protein | - |
| P7F77_RS10655 (P7F77_10660) | - | 2129954..2130628 (-) | 675 | WP_278043632.1 | putative HNHc nuclease | - |
| P7F77_RS10660 (P7F77_10665) | ssbA | 2130642..2131061 (-) | 420 | WP_278043633.1 | single-stranded DNA-binding protein | Machinery gene |
| P7F77_RS10665 (P7F77_10670) | - | 2131061..2131699 (-) | 639 | WP_048667634.1 | ERF family protein | - |
| P7F77_RS10670 (P7F77_10675) | - | 2131699..2132178 (-) | 480 | WP_000002516.1 | siphovirus Gp157 family protein | - |
| P7F77_RS10675 (P7F77_10680) | - | 2132193..2132453 (-) | 261 | WP_048667633.1 | DUF1108 family protein | - |
| P7F77_RS10680 (P7F77_10685) | - | 2132547..2132708 (-) | 162 | WP_000048124.1 | DUF1270 family protein | - |
| P7F77_RS10685 (P7F77_10690) | - | 2132701..2132922 (-) | 222 | WP_000594790.1 | hypothetical protein | - |
| P7F77_RS10690 (P7F77_10695) | - | 2132994..2133659 (+) | 666 | WP_001807461.1 | hypothetical protein | - |
| P7F77_RS10695 (P7F77_10700) | - | 2133680..2133748 (-) | 69 | Protein_2071 | hypothetical protein | - |
| P7F77_RS10700 (P7F77_10705) | - | 2133788..2134012 (-) | 225 | WP_000187184.1 | hypothetical protein | - |
| P7F77_RS10705 (P7F77_10710) | - | 2134013..2134792 (-) | 780 | WP_001148557.1 | phage antirepressor KilAC domain-containing protein | - |
| P7F77_RS10710 (P7F77_10715) | - | 2134849..2135058 (+) | 210 | WP_000642492.1 | hypothetical protein | - |
| P7F77_RS10715 (P7F77_10720) | - | 2135048..2135191 (-) | 144 | WP_000939498.1 | hypothetical protein | - |
| P7F77_RS10720 (P7F77_10725) | - | 2135220..2135996 (-) | 777 | WP_278043635.1 | Rha family transcriptional regulator | - |
| P7F77_RS10725 (P7F77_10730) | - | 2136010..2136255 (-) | 246 | WP_001573844.1 | helix-turn-helix transcriptional regulator | - |
| P7F77_RS10730 (P7F77_10735) | - | 2136447..2136776 (+) | 330 | WP_001573842.1 | helix-turn-helix transcriptional regulator | - |
| P7F77_RS10735 (P7F77_10740) | - | 2136789..2137253 (+) | 465 | WP_000525003.1 | hypothetical protein | - |
| P7F77_RS10740 (P7F77_10745) | - | 2137285..2137965 (+) | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| P7F77_RS10745 (P7F77_10750) | - | 2138177..2139226 (+) | 1050 | WP_001145730.1 | tyrosine-type recombinase/integrase | - |
| P7F77_RS10750 (P7F77_10755) | sufB | 2139294..2140691 (-) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 15614.22 Da Isoelectric Point: 8.4724
>NTDB_id=811060 P7F77_RS10660 WP_278043633.1 2130642..2131061(-) (ssbA) [Staphylococcus aureus strain SA0907]
MLNRTVLVGRLTKDPEYRTTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYDNKEGRRVFVTEVVADSVQFLEPKNNNKQNNQQHNGQTQTGNNPFDNTEADFSDLPF
MLNRTVLVGRLTKDPEYRTTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYDNKEGRRVFVTEVVADSVQFLEPKNNNKQNNQQHNGQTQTGNNPFDNTEADFSDLPF
Nucleotide
Download Length: 420 bp
>NTDB_id=811060 P7F77_RS10660 WP_278043633.1 2130642..2131061(-) (ssbA) [Staphylococcus aureus strain SA0907]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGCGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTTACAAATGCTCAAGGCGAGCGTGAAGCAGACTTTATAAACGTAGTAGTAT
TCAAAAAACAAGCTGAAAACGTTAAAAACTACCTTTCTAAAGGATCACTGGCAGGTGTAGACGGGCGATTACAAACACGC
AGTTACGATAACAAAGAAGGGCGACGTGTATTTGTGACAGAAGTAGTAGCGGACAGCGTTCAATTCTTAGAACCGAAGAA
TAACAACAAACAGAATAACCAACAACACAACGGACAAACTCAAACTGGTAATAATCCGTTCGACAATACCGAAGCAGACT
TTTCTGACTTACCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGCGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTTACAAATGCTCAAGGCGAGCGTGAAGCAGACTTTATAAACGTAGTAGTAT
TCAAAAAACAAGCTGAAAACGTTAAAAACTACCTTTCTAAAGGATCACTGGCAGGTGTAGACGGGCGATTACAAACACGC
AGTTACGATAACAAAGAAGGGCGACGTGTATTTGTGACAGAAGTAGTAGCGGACAGCGTTCAATTCTTAGAACCGAAGAA
TAACAACAAACAGAATAACCAACAACACAACGGACAAACTCAAACTGGTAATAATCCGTTCGACAATACCGAAGCAGACT
TTTCTGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
78.505 |
76.978 |
0.604 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
53.289 |
100 |
0.583 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.273 |
79.137 |
0.453 |
| ssbA | Streptococcus mutans UA159 |
44.538 |
85.612 |
0.381 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
48.113 |
76.259 |
0.367 |