Detailed information
Bioinformatically predicted
Overview
| Name | comYD | Type | Machinery gene |
| Locus tag | P6F23_RS01090 | Genome accession | NZ_CP120953 |
| Coordinates | 188966..189394 (+) | Length | 142 a.a. |
| NCBI ID | WP_000793381.1 | Uniprot ID | A0A8B4RCN7 |
| Organism | Streptococcus agalactiae strain GBSIR0001 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 190255..235935 | 188966..189394 | flank | 861 |
Gene organization within MGE regions
Location: 188966..235935
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6F23_RS01090 (P6F23_01090) | comYD | 188966..189394 (+) | 429 | WP_000793381.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| P6F23_RS01095 (P6F23_01095) | comGE | 189366..189665 (+) | 300 | WP_001867089.1 | competence type IV pilus minor pilin ComGE | - |
| P6F23_RS01100 (P6F23_01100) | comGF | 189619..190080 (+) | 462 | WP_001874060.1 | competence type IV pilus minor pilin ComGF | - |
| P6F23_RS01105 (P6F23_01105) | comGG | 190058..190429 (+) | 372 | WP_000601104.1 | competence type IV pilus minor pilin ComGG | - |
| P6F23_RS01110 (P6F23_01110) | comYH | 190544..191518 (+) | 975 | WP_001008570.1 | class I SAM-dependent methyltransferase | Machinery gene |
| P6F23_RS01115 (P6F23_01115) | - | 191550..192743 (+) | 1194 | WP_000047535.1 | acetate kinase | - |
| P6F23_RS01120 (P6F23_01120) | - | 192894..193100 (+) | 207 | WP_000798242.1 | helix-turn-helix transcriptional regulator | - |
| P6F23_RS01125 (P6F23_01125) | - | 193159..193296 (+) | 138 | WP_001867090.1 | hypothetical protein | - |
| P6F23_RS01130 (P6F23_01130) | - | 193337..193792 (+) | 456 | WP_000905674.1 | hypothetical protein | - |
| P6F23_RS01135 (P6F23_01135) | - | 193861..194526 (+) | 666 | WP_000008111.1 | type II CAAX endopeptidase family protein | - |
| P6F23_RS01140 (P6F23_01140) | proC | 194547..195317 (-) | 771 | WP_001867096.1 | pyrroline-5-carboxylate reductase | - |
| P6F23_RS01145 (P6F23_01145) | pepA | 195387..196454 (-) | 1068 | WP_001281321.1 | glutamyl aminopeptidase | - |
| P6F23_RS01150 (P6F23_01150) | - | 196639..196878 (-) | 240 | WP_000660181.1 | hypothetical protein | - |
| P6F23_RS01155 (P6F23_01155) | - | 197039..197323 (+) | 285 | WP_000791272.1 | DUF4651 domain-containing protein | - |
| P6F23_RS01160 (P6F23_01160) | - | 197320..197643 (+) | 324 | WP_000601792.1 | thioredoxin family protein | - |
| P6F23_RS01165 (P6F23_01165) | ytpR | 197676..198302 (+) | 627 | WP_000578331.1 | YtpR family tRNA-binding protein | - |
| P6F23_RS01170 (P6F23_01170) | - | 198356..199072 (-) | 717 | WP_000186183.1 | class I SAM-dependent methyltransferase | - |
| P6F23_RS01175 (P6F23_01175) | ssbA | 199153..199548 (+) | 396 | WP_000282450.1 | single-stranded DNA-binding protein | Machinery gene |
| P6F23_RS01180 (P6F23_01180) | - | 199671..200315 (+) | 645 | WP_000416612.1 | HAD family hydrolase | - |
| P6F23_RS01185 (P6F23_01185) | - | 200342..202087 (+) | 1746 | WP_000930334.1 | LytS/YhcK type 5TM receptor domain-containing protein | - |
| P6F23_RS01190 (P6F23_01190) | - | 202068..202808 (+) | 741 | WP_000697630.1 | LytTR family transcriptional regulator DNA-binding domain-containing protein | - |
| P6F23_RS01195 (P6F23_01195) | - | 202978..203433 (+) | 456 | WP_000683316.1 | CidA/LrgA family protein | - |
| P6F23_RS01200 (P6F23_01200) | lrgB | 203435..204163 (+) | 729 | WP_000421727.1 | antiholin-like protein LrgB | - |
| P6F23_RS01205 (P6F23_01205) | - | 204406..206034 (+) | 1629 | WP_000170504.1 | ABC transporter substrate-binding protein | - |
| P6F23_RS01210 (P6F23_01210) | - | 206147..207124 (+) | 978 | WP_000680644.1 | ABC transporter permease | - |
| P6F23_RS01215 (P6F23_01215) | - | 207121..207942 (+) | 822 | WP_000603397.1 | ABC transporter permease | - |
| P6F23_RS01220 (P6F23_01220) | - | 207954..208757 (+) | 804 | WP_000140979.1 | ABC transporter ATP-binding protein | - |
| P6F23_RS01225 (P6F23_01225) | - | 208741..209367 (+) | 627 | WP_000171304.1 | ABC transporter ATP-binding protein | - |
| P6F23_RS01230 (P6F23_01230) | treP | 209649..211679 (+) | 2031 | WP_000434610.1 | PTS system trehalose-specific EIIBC component | - |
| P6F23_RS01235 (P6F23_01235) | treC | 211901..213526 (+) | 1626 | WP_000151014.1 | alpha,alpha-phosphotrehalase | - |
| P6F23_RS01240 (P6F23_01240) | - | 213746..215782 (+) | 2037 | WP_000228178.1 | BglG family transcription antiterminator | - |
| P6F23_RS01245 (P6F23_01245) | - | 215785..216069 (+) | 285 | WP_000944235.1 | PTS sugar transporter subunit IIB | - |
| P6F23_RS01250 (P6F23_01250) | - | 216082..217437 (+) | 1356 | WP_000677351.1 | PTS ascorbate transporter subunit IIC | - |
| P6F23_RS01255 (P6F23_01255) | - | 217440..218297 (+) | 858 | WP_000203492.1 | transketolase | - |
| P6F23_RS01260 (P6F23_01260) | - | 218294..219223 (+) | 930 | WP_001203828.1 | transketolase C-terminal domain-containing protein | - |
| P6F23_RS01265 (P6F23_01265) | - | 219332..220591 (+) | 1260 | WP_001203074.1 | ferric reductase-like transmembrane domain-containing protein | - |
| P6F23_RS01270 (P6F23_01270) | rpsO | 220679..220948 (+) | 270 | WP_001018249.1 | 30S ribosomal protein S15 | - |
| P6F23_RS01275 (P6F23_01275) | pnp | 221329..223458 (+) | 2130 | WP_000043857.1 | polyribonucleotide nucleotidyltransferase | - |
| P6F23_RS01280 (P6F23_01280) | - | 223460..224212 (+) | 753 | WP_000204780.1 | SseB family protein | - |
| P6F23_RS01285 (P6F23_01285) | cysE | 224221..224805 (+) | 585 | WP_000539954.1 | serine O-acetyltransferase | - |
| P6F23_RS01290 (P6F23_01290) | - | 224815..224997 (+) | 183 | WP_000656477.1 | hypothetical protein | - |
| P6F23_RS01295 (P6F23_01295) | cysS | 224994..226337 (+) | 1344 | WP_000591129.1 | cysteine--tRNA ligase | - |
| P6F23_RS01300 (P6F23_01300) | - | 226330..226716 (+) | 387 | WP_000568029.1 | Mini-ribonuclease 3 | - |
| P6F23_RS01305 (P6F23_01305) | rlmB | 226819..227574 (+) | 756 | WP_000178023.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
| P6F23_RS01310 (P6F23_01310) | - | 227571..228089 (+) | 519 | WP_000716636.1 | NYN domain-containing protein | - |
| P6F23_RS01315 (P6F23_01315) | - | 228182..229042 (+) | 861 | WP_000143135.1 | DegV family protein | - |
| P6F23_RS01320 (P6F23_01320) | - | 229580..229699 (+) | 120 | Protein_207 | helix-turn-helix domain-containing protein | - |
| P6F23_RS01325 (P6F23_01325) | - | 230017..231183 (-) | 1167 | WP_000160598.1 | IS30-like element ISSag9 family transposase | - |
| P6F23_RS01330 (P6F23_01330) | rplM | 231484..231930 (+) | 447 | WP_001867156.1 | 50S ribosomal protein L13 | - |
| P6F23_RS01335 (P6F23_01335) | rpsI | 231951..232343 (+) | 393 | WP_000035940.1 | 30S ribosomal protein S9 | - |
| P6F23_RS01340 (P6F23_01340) | - | 232489..233643 (-) | 1155 | WP_000110711.1 | site-specific integrase | - |
| P6F23_RS01345 (P6F23_01345) | - | 233698..234216 (-) | 519 | WP_000181342.1 | helix-turn-helix transcriptional regulator | - |
| P6F23_RS01350 (P6F23_01350) | - | 234363..234647 (+) | 285 | WP_001287945.1 | hypothetical protein | - |
| P6F23_RS01355 (P6F23_01355) | - | 234659..235513 (+) | 855 | WP_000005759.1 | phage replisome organizer N-terminal domain-containing protein | - |
| P6F23_RS01360 (P6F23_01360) | - | 235524..235814 (+) | 291 | WP_000158581.1 | DUF5962 family protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16493.15 Da Isoelectric Point: 10.0345
>NTDB_id=809538 P6F23_RS01090 WP_000793381.1 188966..189394(+) (comYD) [Streptococcus agalactiae strain GBSIR0001]
MKNLLLKCKDKKVKAFTLLESLIVLSVVAFMTLVFSTSFNNIFRQVEETIFFISFEHLYRDTQKLSAFGQKKQTLTISHN
YLENTYERLYLPKTVKVVKSDTLAFDANGGNSSLAKIQFECYRKTVTYQLYIGSGNYRKKEN
MKNLLLKCKDKKVKAFTLLESLIVLSVVAFMTLVFSTSFNNIFRQVEETIFFISFEHLYRDTQKLSAFGQKKQTLTISHN
YLENTYERLYLPKTVKVVKSDTLAFDANGGNSSLAKIQFECYRKTVTYQLYIGSGNYRKKEN
Nucleotide
Download Length: 429 bp
>NTDB_id=809538 P6F23_RS01090 WP_000793381.1 188966..189394(+) (comYD) [Streptococcus agalactiae strain GBSIR0001]
ATGAAAAATTTATTGTTAAAATGTAAGGATAAGAAGGTTAAAGCATTTACACTTTTAGAGAGCCTTATTGTATTATCAGT
AGTGGCATTTATGACGTTAGTATTTTCAACATCATTTAATAATATTTTTAGGCAGGTTGAAGAAACAATTTTCTTCATAT
CCTTTGAACATCTTTATAGAGATACTCAGAAATTGAGTGCATTTGGTCAGAAGAAACAAACCCTTACAATCTCTCATAAT
TATCTCGAAAATACTTATGAGAGACTTTATTTACCTAAAACTGTAAAAGTAGTCAAAAGTGACACACTTGCATTTGACGC
TAATGGAGGGAATTCAAGCTTGGCAAAAATTCAATTTGAATGTTATAGAAAAACTGTTACGTATCAATTATATATAGGAA
GTGGTAATTATCGTAAGAAAGAAAATTAG
ATGAAAAATTTATTGTTAAAATGTAAGGATAAGAAGGTTAAAGCATTTACACTTTTAGAGAGCCTTATTGTATTATCAGT
AGTGGCATTTATGACGTTAGTATTTTCAACATCATTTAATAATATTTTTAGGCAGGTTGAAGAAACAATTTTCTTCATAT
CCTTTGAACATCTTTATAGAGATACTCAGAAATTGAGTGCATTTGGTCAGAAGAAACAAACCCTTACAATCTCTCATAAT
TATCTCGAAAATACTTATGAGAGACTTTATTTACCTAAAACTGTAAAAGTAGTCAAAAGTGACACACTTGCATTTGACGC
TAATGGAGGGAATTCAAGCTTGGCAAAAATTCAATTTGAATGTTATAGAAAAACTGTTACGTATCAATTATATATAGGAA
GTGGTAATTATCGTAAGAAAGAAAATTAG
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comYD | Streptococcus mutans UA140 |
52.273 |
92.958 |
0.486 |
| comYD | Streptococcus mutans UA159 |
52.273 |
92.958 |
0.486 |
| comYD | Streptococcus gordonii str. Challis substr. CH1 |
43.662 |
100 |
0.437 |
| comGD/cglD | Streptococcus mitis NCTC 12261 |
41.045 |
94.366 |
0.387 |
| comGD/cglD | Streptococcus pneumoniae TIGR4 |
43.307 |
89.437 |
0.387 |
| comGD/cglD | Streptococcus mitis SK321 |
43.307 |
89.437 |
0.387 |
| comGD/cglD | Streptococcus pneumoniae Rx1 |
42.52 |
89.437 |
0.38 |
| comGD/cglD | Streptococcus pneumoniae D39 |
42.52 |
89.437 |
0.38 |
| comGD/cglD | Streptococcus pneumoniae R6 |
42.52 |
89.437 |
0.38 |