Detailed information
Overview
| Name | comGD | Type | Machinery gene |
| Locus tag | LLHP_RS11835 | Genome accession | NZ_CP120921 |
| Coordinates | 2264282..2264470 (-) | Length | 62 a.a. |
| NCBI ID | WP_014573336.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris subsp. cremoris HP | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2259282..2269470
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLHP_RS11800 (LLHP_11845) | - | 2260208..2261017 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLHP_RS11805 (LLHP_11850) | - | 2261010..2261747 (-) | 738 | WP_011677178.1 | metal ABC transporter ATP-binding protein | - |
| LLHP_RS11810 (LLHP_11855) | - | 2261926..2262768 (-) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LLHP_RS11815 (LLHP_11860) | - | 2262765..2263202 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLHP_RS11820 (LLHP_11865) | comGG | 2263282..2263509 (-) | 228 | WP_228764408.1 | competence protein ComGG | Machinery gene |
| LLHP_RS11825 (LLHP_11870) | comGF | 2263605..2264051 (-) | 447 | WP_011836043.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLHP_RS11830 (LLHP_11875) | comGE | 2264014..2264250 (-) | 237 | WP_014573335.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLHP_RS11835 (LLHP_11880) | comGD | 2264282..2264470 (-) | 189 | WP_014573336.1 | hypothetical protein | Machinery gene |
| LLHP_RS11840 (LLHP_11885) | comGC | 2264672..2265022 (-) | 351 | WP_050574187.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LLHP_RS11845 (LLHP_11890) | comGB | 2265067..2266092 (-) | 1026 | WP_050595614.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LLHP_RS11850 (LLHP_11895) | comGA | 2265992..2266972 (-) | 981 | WP_032951299.1 | competence type IV pilus ATPase ComGA | Machinery gene |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7336.65 Da Isoelectric Point: 8.3463
>NTDB_id=809355 LLHP_RS11835 WP_014573336.1 2264282..2264470(-) (comGD) [Lactococcus cremoris subsp. cremoris HP]
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
Nucleotide
Download Length: 189 bp
>NTDB_id=809355 LLHP_RS11835 WP_014573336.1 2264282..2264470(-) (comGD) [Lactococcus cremoris subsp. cremoris HP]
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD | Lactococcus lactis subsp. cremoris KW2 |
93.548 |
100 |
0.935 |
| comYD | Streptococcus mutans UA140 |
43.396 |
85.484 |
0.371 |
| comYD | Streptococcus mutans UA159 |
43.396 |
85.484 |
0.371 |