Detailed information
Bioinformatically predicted
Overview
| Name | comGG | Type | Machinery gene |
| Locus tag | LLHP_RS11820 | Genome accession | NZ_CP120921 |
| Coordinates | 2263282..2263509 (-) | Length | 75 a.a. |
| NCBI ID | WP_228764408.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris subsp. cremoris HP | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2243806..2263202 | 2263282..2263509 | flank | 80 |
Gene organization within MGE regions
Location: 2243806..2263509
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLHP_RS11715 (LLHP_11760) | - | 2243806..2244741 (+) | 936 | WP_031559015.1 | IS30 family transposase | - |
| LLHP_RS11720 (LLHP_11765) | - | 2244918..2245807 (-) | 890 | Protein_2283 | IS982 family transposase | - |
| LLHP_RS11725 (LLHP_11770) | mscL | 2245916..2246281 (+) | 366 | WP_032951281.1 | large-conductance mechanosensitive channel protein MscL | - |
| LLHP_RS11730 (LLHP_11775) | - | 2246320..2247609 (-) | 1290 | WP_032951279.1 | MATE family efflux transporter | - |
| LLHP_RS11735 (LLHP_11780) | thrC | 2247606..2249096 (-) | 1491 | WP_011677165.1 | threonine synthase | - |
| LLHP_RS11740 (LLHP_11785) | nusG | 2249195..2249752 (-) | 558 | WP_011677166.1 | transcription termination/antitermination protein NusG | - |
| LLHP_RS11745 (LLHP_11790) | secE | 2249959..2250153 (-) | 195 | WP_011677167.1 | preprotein translocase subunit SecE | - |
| LLHP_RS11750 (LLHP_11795) | rpmG | 2250234..2250383 (-) | 150 | WP_011677168.1 | 50S ribosomal protein L33 | - |
| LLHP_RS11755 (LLHP_11800) | - | 2250424..2252241 (-) | 1818 | WP_063280762.1 | acyltransferase family protein | - |
| LLHP_RS11760 (LLHP_11805) | - | 2252343..2254574 (-) | 2232 | WP_032951287.1 | PBP1A family penicillin-binding protein | - |
| LLHP_RS11765 (LLHP_11810) | - | 2254961..2255596 (-) | 636 | WP_011677171.1 | DUF421 domain-containing protein | - |
| LLHP_RS11770 (LLHP_11815) | - | 2255614..2255895 (-) | 282 | WP_257589792.1 | DUF3290 domain-containing protein | - |
| LLHP_RS11775 (LLHP_11820) | - | 2255989..2256924 (+) | 936 | WP_031559015.1 | IS30 family transposase | - |
| LLHP_RS11780 (LLHP_11825) | - | 2256950..2257120 (-) | 171 | Protein_2295 | DUF3290 family protein | - |
| LLHP_RS11785 (LLHP_11830) | - | 2257235..2257612 (-) | 378 | Protein_2296 | pyridoxamine 5'-phosphate oxidase family protein | - |
| LLHP_RS11790 (LLHP_11835) | - | 2257806..2258678 (+) | 873 | WP_032951293.1 | RluA family pseudouridine synthase | - |
| LLHP_RS11800 (LLHP_11845) | - | 2260208..2261017 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLHP_RS11805 (LLHP_11850) | - | 2261010..2261747 (-) | 738 | WP_011677178.1 | metal ABC transporter ATP-binding protein | - |
| LLHP_RS11810 (LLHP_11855) | - | 2261926..2262768 (-) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LLHP_RS11815 (LLHP_11860) | - | 2262765..2263202 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLHP_RS11820 (LLHP_11865) | comGG | 2263282..2263509 (-) | 228 | WP_228764408.1 | competence protein ComGG | Machinery gene |
Sequence
Protein
Download Length: 75 a.a. Molecular weight: 8406.73 Da Isoelectric Point: 9.0864
>NTDB_id=809352 LLHP_RS11820 WP_228764408.1 2263282..2263509(-) (comGG) [Lactococcus cremoris subsp. cremoris HP]
MKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSNKTYCFDVRLKDGRIYQIVK
MKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSNKTYCFDVRLKDGRIYQIVK
Nucleotide
Download Length: 228 bp
>NTDB_id=809352 LLHP_RS11820 WP_228764408.1 2263282..2263509(-) (comGG) [Lactococcus cremoris subsp. cremoris HP]
TTGAAAATAGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCA
ACTTAATTTTGATTGTGGAAATTTAACTTACAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTG
TTAGTAATAAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTATCAAATAGTAAAGTAA
TTGAAAATAGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCA
ACTTAATTTTGATTGTGGAAATTTAACTTACAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTG
TTAGTAATAAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTATCAAATAGTAAAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGG | Lactococcus lactis subsp. cremoris KW2 |
96 |
100 |
0.96 |