Detailed information NTG0808903

Bioinformatically predicted

Overview

• Name: comGD/cglD
• Type: Machinery gene
• Locus tag: RMP65_RS00780
• Genome accession: NZ_CP135089
• Coordinates: 121638..122045 (+)
• Length: 135 a.a.
• NCBI ID: WP_074391329.1
• Uniprot ID: -
• Organism: Streptococcus suis strain ID34567
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 116638..127045

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RMP65_RS00755 (RMP65_00755)	-	118037..118411 (+)	375	WP_024385120.1	DUF1033 family protein	-
RMP65_RS00760 (RMP65_00760)	-	118439..119389 (-)	951	WP_074391326.1	S66 peptidase family protein	-
RMP65_RS00765 (RMP65_00765)	comGA	119475..120425 (+)	951	WP_074391327.1	competence type IV pilus ATPase ComGA	Machinery gene
RMP65_RS00770 (RMP65_00770)	comGB	120337..121374 (+)	1038	WP_269472402.1	competence type IV pilus assembly protein ComGB	Machinery gene
RMP65_RS00775 (RMP65_00775)	comGC	121376..121657 (+)	282	WP_074391328.1	competence type IV pilus major pilin ComGC	Machinery gene
RMP65_RS00780 (RMP65_00780)	comGD/cglD	121638..122045 (+)	408	WP_074391329.1	competence type IV pilus minor pilin ComGD	Machinery gene
RMP65_RS00785 (RMP65_00785)	comGE	122017..122310 (+)	294	WP_024401507.1	competence type IV pilus minor pilin ComGE	Machinery gene
RMP65_RS00790 (RMP65_00790)	comGF/cglF	122297..122731 (+)	435	WP_044762030.1	competence type IV pilus minor pilin ComGF	Machinery gene
RMP65_RS00795 (RMP65_00795)	comGG	122709..123122 (+)	414	WP_074391330.1	competence type IV pilus minor pilin ComGG	-
RMP65_RS00800 (RMP65_00800)	comGH	123172..124125 (+)	954	WP_024414316.1	class I SAM-dependent methyltransferase	Machinery gene
RMP65_RS00805 (RMP65_00805)	-	124175..125362 (+)	1188	WP_044680792.1	acetate kinase	-
RMP65_RS00810 (RMP65_00810)	-	125679..126230 (+)	552	WP_044680793.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 135 a.a.
• Molecular weight: 15181.30 Da
• Isoelectric Point: 9.6759

>NTDB_id=808903 RMP65_RS00780 WP_074391329.1 121638..122045(+) (comGD/cglD) [Streptococcus suis strain ID34567]
MLRRKNKAFTLFESLLTLFVVSFLAVSLSGTVQTAFQSVQEEIFLWEFEGIYKDSQKLAASSHQTVSLAIGGQEVTNGYQ
AVQVPRNVEVLEGKTITFEENGGNSSLAKIRFRLSRKTVTYQLYIGSGRYKKTEE

Nucleotide

• Length: 408 bp

>NTDB_id=808903 RMP65_RS00780 WP_074391329.1 121638..122045(+) (comGD/cglD) [Streptococcus suis strain ID34567]
ATGCTACGGCGAAAAAATAAGGCCTTCACCCTGTTTGAAAGTCTGCTGACCTTGTTTGTTGTCAGTTTTTTAGCTGTTTC
TTTATCAGGAACGGTGCAAACGGCCTTTCAGTCTGTTCAAGAAGAGATTTTTCTCTGGGAATTTGAGGGCATCTATAAAG
ACAGTCAGAAACTGGCAGCTAGTTCCCACCAAACAGTGAGTCTAGCTATCGGTGGACAGGAGGTTACCAATGGTTATCAG
GCTGTACAGGTACCCAGAAATGTAGAAGTATTGGAAGGGAAGACCATCACATTTGAAGAAAATGGTGGAAATTCTTCTCT
GGCCAAGATTCGTTTTCGGCTTAGTCGAAAGACAGTCACGTATCAATTATATATAGGGAGTGGTCGCTATAAGAAAACAG
AAGAATAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD/cglD	Streptococcus pneumoniae D39	48.062	95.556	0.459
comGD/cglD	Streptococcus pneumoniae Rx1	48.062	95.556	0.459
comGD/cglD	Streptococcus pneumoniae R6	48.062	95.556	0.459
comGD/cglD	Streptococcus pneumoniae TIGR4	48.062	95.556	0.459
comGD/cglD	Streptococcus mitis NCTC 12261	47.287	95.556	0.452
comGD/cglD	Streptococcus mitis SK321	47.287	95.556	0.452
comGD	Streptococcus mutans UA140	47.287	95.556	0.452
comGD	Streptococcus mutans UA159	47.287	95.556	0.452
comGD	Streptococcus gordonii str. Challis substr. CH1	47.244	94.074	0.444
comGD	Lactococcus lactis subsp. cremoris KW2	38.281	94.815	0.363