Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   P5649_RS09745 Genome accession   NZ_CP120613
Coordinates   1900282..1900449 (+) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain DSM 23521     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 1895282..1905449
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5649_RS09715 (P5649_09715) pncB 1895427..1896899 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  P5649_RS09720 (P5649_09720) pdeH 1897036..1898265 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  P5649_RS09725 (P5649_09725) - 1898241..1898609 (-) 369 WP_003243784.1 hypothetical protein -
  P5649_RS09730 (P5649_09730) - 1898723..1898848 (-) 126 WP_003228793.1 hypothetical protein -
  P5649_RS09735 (P5649_09735) degQ 1899070..1899210 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  P5649_RS09740 (P5649_09740) comQ 1899395..1900294 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  P5649_RS09745 (P5649_09745) comX 1900282..1900449 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  P5649_RS09750 (P5649_09750) comP 1900464..1902773 (+) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  P5649_RS09755 (P5649_09755) comA 1902854..1903498 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  P5649_RS09760 (P5649_09760) yuxO 1903517..1903897 (+) 381 WP_003228810.1 hotdog fold thioesterase -
  P5649_RS09765 (P5649_09765) mnhG 1903936..1904310 (-) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  P5649_RS09770 (P5649_09770) mrpF 1904294..1904578 (-) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  P5649_RS09775 (P5649_09775) mrpE 1904578..1905054 (-) 477 WP_003244015.1 Na+/H+ antiporter subunit E -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=806903 P5649_RS09745 WP_003242801.1 1900282..1900449(+) (comX) [Bacillus subtilis strain DSM 23521]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=806903 P5649_RS09745 WP_003242801.1 1900282..1900449(+) (comX) [Bacillus subtilis strain DSM 23521]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1