Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   P5649_RS09735 Genome accession   NZ_CP120613
Coordinates   1899070..1899210 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain DSM 23521     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1894070..1904210
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5649_RS09705 (P5649_09705) yueI 1894365..1894763 (+) 399 WP_003242987.1 YueI family protein -
  P5649_RS09710 (P5649_09710) pncA 1894860..1895411 (+) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  P5649_RS09715 (P5649_09715) pncB 1895427..1896899 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  P5649_RS09720 (P5649_09720) pdeH 1897036..1898265 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  P5649_RS09725 (P5649_09725) - 1898241..1898609 (-) 369 WP_003243784.1 hypothetical protein -
  P5649_RS09730 (P5649_09730) - 1898723..1898848 (-) 126 WP_003228793.1 hypothetical protein -
  P5649_RS09735 (P5649_09735) degQ 1899070..1899210 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  P5649_RS09740 (P5649_09740) comQ 1899395..1900294 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  P5649_RS09745 (P5649_09745) comX 1900282..1900449 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  P5649_RS09750 (P5649_09750) comP 1900464..1902773 (+) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  P5649_RS09755 (P5649_09755) comA 1902854..1903498 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  P5649_RS09760 (P5649_09760) yuxO 1903517..1903897 (+) 381 WP_003228810.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=806901 P5649_RS09735 WP_003220708.1 1899070..1899210(+) (degQ) [Bacillus subtilis strain DSM 23521]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=806901 P5649_RS09735 WP_003220708.1 1899070..1899210(+) (degQ) [Bacillus subtilis strain DSM 23521]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1