Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | P3T94_RS06120 | Genome accession | NZ_CP120191 |
| Coordinates | 1309418..1309873 (+) | Length | 151 a.a. |
| NCBI ID | WP_320409348.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain Dog010 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1300452..1344488 | 1309418..1309873 | within | 0 |
Gene organization within MGE regions
Location: 1300452..1344488
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3T94_RS06050 (P3T94_06050) | - | 1300452..1301675 (-) | 1224 | WP_320409347.1 | site-specific integrase | - |
| P3T94_RS06055 (P3T94_06055) | - | 1301736..1302344 (-) | 609 | WP_015729226.1 | hypothetical protein | - |
| P3T94_RS06060 (P3T94_06060) | - | 1302391..1302852 (-) | 462 | WP_015729225.1 | ImmA/IrrE family metallo-endopeptidase | - |
| P3T94_RS06065 (P3T94_06065) | - | 1302866..1303177 (-) | 312 | WP_015729224.1 | helix-turn-helix domain-containing protein | - |
| P3T94_RS06070 (P3T94_06070) | - | 1303353..1303580 (+) | 228 | WP_015729223.1 | hypothetical protein | - |
| P3T94_RS06075 (P3T94_06075) | - | 1303777..1303959 (+) | 183 | WP_015729222.1 | hypothetical protein | - |
| P3T94_RS06080 (P3T94_06080) | - | 1303983..1304474 (-) | 492 | WP_037544203.1 | hypothetical protein | - |
| P3T94_RS06085 (P3T94_06085) | - | 1304536..1304799 (+) | 264 | WP_110148360.1 | helix-turn-helix domain-containing protein | - |
| P3T94_RS06090 (P3T94_06090) | - | 1304814..1304990 (+) | 177 | WP_172968882.1 | hypothetical protein | - |
| P3T94_RS06095 (P3T94_06095) | - | 1304992..1305288 (+) | 297 | WP_103866757.1 | DUF2482 family protein | - |
| P3T94_RS06100 (P3T94_06100) | - | 1305375..1305632 (+) | 258 | WP_100006936.1 | DUF1108 family protein | - |
| P3T94_RS06105 (P3T94_06105) | - | 1305648..1307600 (+) | 1953 | WP_275302436.1 | AAA family ATPase | - |
| P3T94_RS12515 | - | 1307590..1307790 (+) | 201 | WP_110144873.1 | helix-turn-helix domain-containing protein | - |
| P3T94_RS06110 (P3T94_06110) | - | 1307804..1308718 (+) | 915 | WP_214528123.1 | recombinase RecT | - |
| P3T94_RS06115 (P3T94_06115) | - | 1308781..1309425 (+) | 645 | WP_214528125.1 | MBL fold metallo-hydrolase | - |
| P3T94_RS06120 (P3T94_06120) | ssbA | 1309418..1309873 (+) | 456 | WP_320409348.1 | single-stranded DNA-binding protein | Machinery gene |
| P3T94_RS06125 (P3T94_06125) | - | 1309888..1310295 (+) | 408 | WP_037542877.1 | hypothetical protein | - |
| P3T94_RS06130 (P3T94_06130) | - | 1310311..1311030 (+) | 720 | WP_037542879.1 | hypothetical protein | - |
| P3T94_RS06135 (P3T94_06135) | - | 1311079..1311846 (+) | 768 | WP_320409349.1 | DnaD domain protein | - |
| P3T94_RS06140 (P3T94_06140) | - | 1311861..1312643 (+) | 783 | WP_199613207.1 | ATP-binding protein | - |
| P3T94_RS06145 (P3T94_06145) | - | 1312640..1312807 (+) | 168 | WP_233510688.1 | hypothetical protein | - |
| P3T94_RS06150 (P3T94_06150) | - | 1312807..1313013 (+) | 207 | WP_015729207.1 | hypothetical protein | - |
| P3T94_RS06155 (P3T94_06155) | - | 1313163..1313414 (+) | 252 | WP_130922111.1 | hypothetical protein | - |
| P3T94_RS06160 (P3T94_06160) | - | 1313447..1313641 (+) | 195 | WP_233508801.1 | SAV1978 family virulence-associated passenger protein | - |
| P3T94_RS06165 (P3T94_06165) | - | 1313647..1313832 (+) | 186 | WP_103866772.1 | hypothetical protein | - |
| P3T94_RS06170 (P3T94_06170) | - | 1313829..1314179 (+) | 351 | WP_015978006.1 | YopX family protein | - |
| P3T94_RS06175 (P3T94_06175) | - | 1314179..1314391 (+) | 213 | WP_320409350.1 | hypothetical protein | - |
| P3T94_RS06180 (P3T94_06180) | - | 1314393..1314926 (+) | 534 | WP_233509766.1 | MazG-like family protein | - |
| P3T94_RS06185 (P3T94_06185) | - | 1314947..1315390 (+) | 444 | WP_037542895.1 | hypothetical protein | - |
| P3T94_RS06190 (P3T94_06190) | - | 1315515..1315928 (+) | 414 | WP_103866780.1 | sigma-70 family RNA polymerase sigma factor | - |
| P3T94_RS06195 (P3T94_06195) | - | 1316212..1316547 (+) | 336 | WP_015729199.1 | HNH endonuclease | - |
| P3T94_RS06200 (P3T94_06200) | - | 1316684..1316983 (+) | 300 | WP_100006922.1 | P27 family phage terminase small subunit | - |
| P3T94_RS06205 (P3T94_06205) | - | 1316980..1318620 (+) | 1641 | WP_100006921.1 | terminase large subunit domain-containing protein | - |
| P3T94_RS06210 (P3T94_06210) | - | 1318635..1319789 (+) | 1155 | WP_199613209.1 | phage portal protein | - |
| P3T94_RS06215 (P3T94_06215) | - | 1319779..1320501 (+) | 723 | WP_199613210.1 | head maturation protease, ClpP-related | - |
| P3T94_RS06220 (P3T94_06220) | - | 1320530..1321657 (+) | 1128 | WP_110148346.1 | phage major capsid protein | - |
| P3T94_RS06225 (P3T94_06225) | - | 1321726..1322022 (+) | 297 | WP_015729193.1 | hypothetical protein | - |
| P3T94_RS06230 (P3T94_06230) | - | 1322003..1322365 (+) | 363 | WP_199613211.1 | hypothetical protein | - |
| P3T94_RS06235 (P3T94_06235) | - | 1322362..1322763 (+) | 402 | WP_037542908.1 | hypothetical protein | - |
| P3T94_RS06240 (P3T94_06240) | - | 1322765..1323160 (+) | 396 | WP_037542910.1 | hypothetical protein | - |
| P3T94_RS06245 (P3T94_06245) | - | 1323200..1323880 (+) | 681 | WP_037542920.1 | major tail protein | - |
| P3T94_RS06250 (P3T94_06250) | - | 1323975..1324436 (+) | 462 | WP_015729188.1 | Ig-like domain-containing protein | - |
| P3T94_RS06255 (P3T94_06255) | gpG | 1324544..1324894 (+) | 351 | WP_103866792.1 | phage tail assembly chaperone G | - |
| P3T94_RS06260 (P3T94_06260) | - | 1324936..1325091 (+) | 156 | WP_168429803.1 | hypothetical protein | - |
| P3T94_RS06265 (P3T94_06265) | - | 1325105..1330690 (+) | 5586 | WP_320409227.1 | phage tail tape measure protein | - |
| P3T94_RS06270 (P3T94_06270) | - | 1330693..1331517 (+) | 825 | WP_015729184.1 | phage tail domain-containing protein | - |
| P3T94_RS06275 (P3T94_06275) | - | 1331518..1333092 (+) | 1575 | WP_250882457.1 | prophage endopeptidase tail family protein | - |
| P3T94_RS06280 (P3T94_06280) | - | 1333079..1333279 (+) | 201 | WP_015729182.1 | hypothetical protein | - |
| P3T94_RS06285 (P3T94_06285) | - | 1333286..1333906 (+) | 621 | WP_015729181.1 | hypothetical protein | - |
| P3T94_RS06290 (P3T94_06290) | - | 1333918..1334949 (+) | 1032 | WP_037542926.1 | SGNH/GDSL hydrolase family protein | - |
| P3T94_RS06295 (P3T94_06295) | - | 1334966..1336237 (+) | 1272 | WP_103866804.1 | phage baseplate upper protein | - |
| P3T94_RS06300 (P3T94_06300) | - | 1336308..1338308 (+) | 2001 | WP_136083945.1 | BppU family phage baseplate upper protein | - |
| P3T94_RS06305 (P3T94_06305) | - | 1338320..1338751 (+) | 432 | WP_037542931.1 | holin family protein | - |
| P3T94_RS06310 (P3T94_06310) | - | 1338764..1339711 (+) | 948 | WP_103866808.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| P3T94_RS06315 (P3T94_06315) | - | 1339848..1340195 (-) | 348 | WP_015729174.1 | hypothetical protein | - |
| P3T94_RS06320 (P3T94_06320) | - | 1340192..1340344 (-) | 153 | WP_015729173.1 | ribbon-helix-helix domain-containing protein | - |
| P3T94_RS06325 (P3T94_06325) | - | 1340474..1341136 (+) | 663 | WP_015729172.1 | hypothetical protein | - |
| P3T94_RS06330 (P3T94_06330) | - | 1341126..1341488 (+) | 363 | WP_037542934.1 | hypothetical protein | - |
| P3T94_RS06335 (P3T94_06335) | - | 1341548..1342699 (+) | 1152 | WP_015729170.1 | SNF2-related protein | - |
| P3T94_RS06340 (P3T94_06340) | - | 1342699..1343988 (+) | 1290 | WP_320409228.1 | DUF3440 domain-containing protein | - |
| P3T94_RS06345 (P3T94_06345) | - | 1343982..1344488 (+) | 507 | WP_320409356.1 | ParB/RepB/Spo0J family partition protein | - |
Sequence
Protein
Download Length: 151 a.a. Molecular weight: 16719.69 Da Isoelectric Point: 7.7102
>NTDB_id=804448 P3T94_RS06120 WP_320409348.1 1309418..1309873(+) (ssbA) [Staphylococcus pseudintermedius strain Dog010]
MINRVVLVGRLTKNPELRNTQSGTSVCSFTLAVNRTFTNAQGEREADFINCIAFKKTAENIINYLSKGNLAGVDGRIQSR
SYENKKGQRVYVTEVICDSVQFLEPKNTSQKQDGIASGQYQPKANHVAATSQNPFVNINDSIDISDDDLPF
MINRVVLVGRLTKNPELRNTQSGTSVCSFTLAVNRTFTNAQGEREADFINCIAFKKTAENIINYLSKGNLAGVDGRIQSR
SYENKKGQRVYVTEVICDSVQFLEPKNTSQKQDGIASGQYQPKANHVAATSQNPFVNINDSIDISDDDLPF
Nucleotide
Download Length: 456 bp
>NTDB_id=804448 P3T94_RS06120 WP_320409348.1 1309418..1309873(+) (ssbA) [Staphylococcus pseudintermedius strain Dog010]
ATGATTAATAGAGTTGTACTTGTAGGTCGATTAACTAAAAATCCTGAATTAAGAAATACACAAAGCGGAACAAGTGTTTG
TAGTTTCACGCTTGCTGTAAATCGTACATTTACGAATGCGCAAGGGGAGCGTGAAGCGGATTTCATTAACTGTATTGCTT
TTAAAAAAACAGCAGAGAACATTATTAACTATTTGTCAAAAGGAAATCTTGCAGGTGTAGATGGTCGCATACAATCACGC
AGTTACGAAAACAAAAAGGGACAACGCGTATATGTTACTGAGGTTATATGTGACAGTGTTCAGTTTTTAGAACCTAAAAA
TACCAGTCAAAAACAAGACGGTATAGCATCCGGACAATATCAACCAAAAGCAAATCATGTCGCTGCTACAAGTCAAAATC
CATTTGTTAATATTAATGATTCAATTGATATTAGTGACGACGATTTACCATTCTAA
ATGATTAATAGAGTTGTACTTGTAGGTCGATTAACTAAAAATCCTGAATTAAGAAATACACAAAGCGGAACAAGTGTTTG
TAGTTTCACGCTTGCTGTAAATCGTACATTTACGAATGCGCAAGGGGAGCGTGAAGCGGATTTCATTAACTGTATTGCTT
TTAAAAAAACAGCAGAGAACATTATTAACTATTTGTCAAAAGGAAATCTTGCAGGTGTAGATGGTCGCATACAATCACGC
AGTTACGAAAACAAAAAGGGACAACGCGTATATGTTACTGAGGTTATATGTGACAGTGTTCAGTTTTTAGAACCTAAAAA
TACCAGTCAAAAACAAGACGGTATAGCATCCGGACAATATCAACCAAAAGCAAATCATGTCGCTGCTACAAGTCAAAATC
CATTTGTTAATATTAATGATTCAATTGATATTAGTGACGACGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
53.488 |
100 |
0.609 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.576 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.522 |
74.834 |
0.43 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.741 |
89.404 |
0.364 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.741 |
89.404 |
0.364 |