Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | P3T86_RS09920 | Genome accession | NZ_CP120099 |
| Coordinates | 2068273..2068713 (-) | Length | 146 a.a. |
| NCBI ID | WP_323702049.1 | Uniprot ID | - |
| Organism | Staphylococcus nepalensis strain Dog109 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2030896..2074132 | 2068273..2068713 | within | 0 |
Gene organization within MGE regions
Location: 2030896..2074132
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3T86_RS09645 (P3T86_09645) | - | 2030896..2032341 (-) | 1446 | WP_323702006.1 | SH3 domain-containing protein | - |
| P3T86_RS09650 (P3T86_09650) | - | 2032399..2032719 (-) | 321 | WP_323702007.1 | holin | - |
| P3T86_RS09655 (P3T86_09655) | - | 2032946..2033317 (-) | 372 | WP_323702008.1 | DUF2951 family protein | - |
| P3T86_RS09660 (P3T86_09660) | - | 2033391..2033558 (-) | 168 | WP_156855797.1 | hypothetical protein | - |
| P3T86_RS09665 (P3T86_09665) | - | 2033558..2034346 (-) | 789 | WP_323702009.1 | serine protease | - |
| P3T86_RS09670 (P3T86_09670) | - | 2034385..2034525 (-) | 141 | WP_075140968.1 | XkdX family protein | - |
| P3T86_RS09675 (P3T86_09675) | - | 2034529..2034951 (-) | 423 | WP_323702010.1 | hypothetical protein | - |
| P3T86_RS09680 (P3T86_09680) | - | 2034953..2035132 (-) | 180 | WP_323702011.1 | hypothetical protein | - |
| P3T86_RS09685 (P3T86_09685) | - | 2035145..2036587 (-) | 1443 | WP_323702012.1 | BppU family phage baseplate upper protein | - |
| P3T86_RS09690 (P3T86_09690) | - | 2036584..2038650 (-) | 2067 | WP_323702013.1 | tail fiber domain-containing protein | - |
| P3T86_RS09695 (P3T86_09695) | - | 2038664..2039146 (-) | 483 | WP_323702014.1 | hypothetical protein | - |
| P3T86_RS09700 (P3T86_09700) | - | 2039151..2041670 (-) | 2520 | WP_410254339.1 | phage tail tip lysozyme | - |
| P3T86_RS09710 (P3T86_09710) | - | 2041680..2042510 (-) | 831 | WP_323702015.1 | phage tail domain-containing protein | - |
| P3T86_RS09715 (P3T86_09715) | - | 2042512..2048430 (-) | 5919 | WP_323702016.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| P3T86_RS09720 (P3T86_09720) | gpGT | 2048459..2048977 (-) | 519 | WP_210139275.1 | phage tail assembly chaperone GT | - |
| P3T86_RS09725 (P3T86_09725) | gpG | 2048993..2049355 (-) | 363 | WP_323702017.1 | phage tail assembly chaperone G | - |
| P3T86_RS09730 (P3T86_09730) | - | 2049502..2050113 (-) | 612 | WP_210139257.1 | major tail protein | - |
| P3T86_RS09735 (P3T86_09735) | - | 2050116..2050529 (-) | 414 | WP_323702018.1 | hypothetical protein | - |
| P3T86_RS09740 (P3T86_09740) | - | 2050529..2050921 (-) | 393 | WP_323702019.1 | hypothetical protein | - |
| P3T86_RS09745 (P3T86_09745) | - | 2050912..2051244 (-) | 333 | WP_323702020.1 | hypothetical protein | - |
| P3T86_RS09750 (P3T86_09750) | - | 2051234..2051533 (-) | 300 | WP_323702021.1 | head-tail connector protein | - |
| P3T86_RS09755 (P3T86_09755) | - | 2051550..2052008 (-) | 459 | WP_323702022.1 | Ig domain-containing protein | - |
| P3T86_RS09760 (P3T86_09760) | - | 2052103..2053329 (-) | 1227 | WP_323702023.1 | phage major capsid protein | - |
| P3T86_RS09765 (P3T86_09765) | - | 2053423..2054025 (-) | 603 | WP_323702024.1 | HK97 family phage prohead protease | - |
| P3T86_RS09770 (P3T86_09770) | - | 2054018..2055289 (-) | 1272 | WP_323702025.1 | phage portal protein | - |
| P3T86_RS09775 (P3T86_09775) | - | 2055305..2055511 (-) | 207 | WP_323702026.1 | hypothetical protein | - |
| P3T86_RS09780 (P3T86_09780) | - | 2055522..2055680 (-) | 159 | WP_323702027.1 | hypothetical protein | - |
| P3T86_RS09785 (P3T86_09785) | - | 2055692..2057398 (-) | 1707 | WP_323702028.1 | terminase large subunit | - |
| P3T86_RS09790 (P3T86_09790) | - | 2057391..2057855 (-) | 465 | WP_323702029.1 | phage terminase small subunit P27 family | - |
| P3T86_RS14180 | - | 2058165..2058365 (-) | 201 | WP_410254342.1 | HNH endonuclease | - |
| P3T86_RS09795 (P3T86_09795) | - | 2058654..2058863 (-) | 210 | WP_323702030.1 | hypothetical protein | - |
| P3T86_RS09800 (P3T86_09800) | - | 2059189..2059602 (-) | 414 | WP_323702031.1 | hypothetical protein | - |
| P3T86_RS09805 (P3T86_09805) | - | 2059620..2059943 (-) | 324 | WP_323702032.1 | hypothetical protein | - |
| P3T86_RS09810 (P3T86_09810) | - | 2059954..2060127 (-) | 174 | WP_210139241.1 | hypothetical protein | - |
| P3T86_RS09815 (P3T86_09815) | - | 2060129..2060329 (-) | 201 | WP_323702033.1 | hypothetical protein | - |
| P3T86_RS09820 (P3T86_09820) | - | 2060329..2060673 (-) | 345 | WP_323702034.1 | hypothetical protein | - |
| P3T86_RS09825 (P3T86_09825) | rinB | 2060670..2061017 (-) | 348 | WP_323702035.1 | transcriptional activator RinB | - |
| P3T86_RS09830 (P3T86_09830) | - | 2061014..2061178 (-) | 165 | WP_323702036.1 | hypothetical protein | - |
| P3T86_RS09835 (P3T86_09835) | - | 2061178..2061636 (-) | 459 | WP_323702037.1 | hypothetical protein | - |
| P3T86_RS09840 (P3T86_09840) | - | 2061639..2061854 (-) | 216 | WP_323702038.1 | DUF1381 domain-containing protein | - |
| P3T86_RS09845 (P3T86_09845) | - | 2061851..2062033 (-) | 183 | WP_323702039.1 | hypothetical protein | - |
| P3T86_RS09850 (P3T86_09850) | - | 2062047..2062223 (-) | 177 | WP_207572581.1 | hypothetical protein | - |
| P3T86_RS09855 (P3T86_09855) | - | 2062272..2062802 (-) | 531 | WP_323702040.1 | dUTP pyrophosphatase | - |
| P3T86_RS09860 (P3T86_09860) | - | 2062799..2063176 (-) | 378 | WP_323702041.1 | hypothetical protein | - |
| P3T86_RS09865 (P3T86_09865) | - | 2063269..2063670 (-) | 402 | WP_323702042.1 | hypothetical protein | - |
| P3T86_RS09870 (P3T86_09870) | - | 2063861..2064166 (-) | 306 | WP_323702043.1 | DUF1140 family protein | - |
| P3T86_RS09875 (P3T86_09875) | - | 2064167..2064697 (-) | 531 | WP_323702044.1 | DUF3310 domain-containing protein | - |
| P3T86_RS09880 (P3T86_09880) | - | 2064698..2065048 (-) | 351 | WP_323702045.1 | SA1788 family PVL leukocidin-associated protein | - |
| P3T86_RS09885 (P3T86_09885) | - | 2065050..2065238 (-) | 189 | WP_207572571.1 | hypothetical protein | - |
| P3T86_RS09890 (P3T86_09890) | - | 2065231..2065641 (-) | 411 | WP_323702046.1 | RusA family crossover junction endodeoxyribonuclease | - |
| P3T86_RS09895 (P3T86_09895) | - | 2065652..2065870 (-) | 219 | WP_323702047.1 | hypothetical protein | - |
| P3T86_RS09900 (P3T86_09900) | - | 2065871..2066032 (-) | 162 | WP_096810584.1 | hypothetical protein | - |
| P3T86_RS09905 (P3T86_09905) | - | 2066026..2066799 (-) | 774 | WP_119487798.1 | ATP-binding protein | - |
| P3T86_RS09910 (P3T86_09910) | - | 2066810..2067577 (-) | 768 | WP_096810586.1 | DnaD domain protein | - |
| P3T86_RS09915 (P3T86_09915) | - | 2067564..2068244 (-) | 681 | WP_323702048.1 | putative HNHc nuclease | - |
| P3T86_RS09920 (P3T86_09920) | ssbA | 2068273..2068713 (-) | 441 | WP_323702049.1 | single-stranded DNA-binding protein | Machinery gene |
| P3T86_RS09925 (P3T86_09925) | - | 2068703..2069332 (-) | 630 | WP_323702052.1 | DUF1071 domain-containing protein | - |
| P3T86_RS09930 (P3T86_09930) | - | 2069325..2069582 (-) | 258 | WP_323702054.1 | DUF2483 family protein | - |
| P3T86_RS09935 (P3T86_09935) | - | 2069576..2069842 (-) | 267 | WP_323702057.1 | DUF1108 family protein | - |
| P3T86_RS09940 (P3T86_09940) | - | 2069911..2070087 (-) | 177 | WP_323702060.1 | hypothetical protein | - |
| P3T86_RS09945 (P3T86_09945) | - | 2070099..2070416 (-) | 318 | WP_323702062.1 | DUF771 domain-containing protein | - |
| P3T86_RS09950 (P3T86_09950) | - | 2070395..2070895 (-) | 501 | WP_323702063.1 | hypothetical protein | - |
| P3T86_RS09955 (P3T86_09955) | - | 2071008..2071202 (-) | 195 | WP_323702065.1 | hypothetical protein | - |
| P3T86_RS09960 (P3T86_09960) | - | 2071413..2071712 (+) | 300 | WP_323702067.1 | helix-turn-helix transcriptional regulator | - |
| P3T86_RS09965 (P3T86_09965) | - | 2071733..2072221 (+) | 489 | WP_323702069.1 | ImmA/IrrE family metallo-endopeptidase | - |
| P3T86_RS09970 (P3T86_09970) | - | 2072345..2073016 (+) | 672 | WP_323702071.1 | DUF4352 domain-containing protein | - |
| P3T86_RS09975 (P3T86_09975) | - | 2073077..2074132 (+) | 1056 | WP_323702073.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 146 a.a. Molecular weight: 16351.09 Da Isoelectric Point: 5.2482
>NTDB_id=802948 P3T86_RS09920 WP_323702049.1 2068273..2068713(-) (ssbA) [Staphylococcus nepalensis strain Dog109]
MINRVVLVGRLTKDPEFRTTPSGVNVANFTLAVNRTFTNAQGEREADFINVVVFKKQAENVNNYLFKGSLAGVDGRIQSR
SYENKEGQRIFVTEVAADSVQFLEPKGNNNQQNVSRGQQISTNDRQARNENPFVNSVDVDPDDLPF
MINRVVLVGRLTKDPEFRTTPSGVNVANFTLAVNRTFTNAQGEREADFINVVVFKKQAENVNNYLFKGSLAGVDGRIQSR
SYENKEGQRIFVTEVAADSVQFLEPKGNNNQQNVSRGQQISTNDRQARNENPFVNSVDVDPDDLPF
Nucleotide
Download Length: 441 bp
>NTDB_id=802948 P3T86_RS09920 WP_323702049.1 2068273..2068713(-) (ssbA) [Staphylococcus nepalensis strain Dog109]
ATGATAAATAGAGTAGTGTTAGTTGGTCGTTTAACTAAAGACCCAGAGTTCAGAACAACACCATCTGGAGTGAATGTGGC
GAATTTTACCTTAGCTGTTAACAGAACGTTTACAAATGCTCAAGGAGAACGTGAAGCAGACTTTATCAATGTAGTTGTTT
TTAAAAAACAAGCAGAAAATGTAAACAATTACTTATTCAAAGGCAGTTTAGCTGGTGTTGATGGCCGTATACAGTCACGT
AGTTATGAAAATAAAGAAGGTCAACGCATATTTGTAACAGAAGTAGCAGCAGATAGTGTTCAATTTTTAGAACCAAAAGG
AAACAACAATCAACAAAATGTTTCAAGAGGACAACAGATTAGCACAAATGACCGACAAGCAAGAAATGAAAATCCATTTG
TAAACAGTGTAGATGTGGACCCGGACGATTTGCCATTTTGA
ATGATAAATAGAGTAGTGTTAGTTGGTCGTTTAACTAAAGACCCAGAGTTCAGAACAACACCATCTGGAGTGAATGTGGC
GAATTTTACCTTAGCTGTTAACAGAACGTTTACAAATGCTCAAGGAGAACGTGAAGCAGACTTTATCAATGTAGTTGTTT
TTAAAAAACAAGCAGAAAATGTAAACAATTACTTATTCAAAGGCAGTTTAGCTGGTGTTGATGGCCGTATACAGTCACGT
AGTTATGAAAATAAAGAAGGTCAACGCATATTTGTAACAGAAGTAGCAGCAGATAGTGTTCAATTTTTAGAACCAAAAGG
AAACAACAATCAACAAAATGTTTCAAGAGGACAACAGATTAGCACAAATGACCGACAAGCAAGAAATGAAAATCCATTTG
TAAACAGTGTAGATGTGGACCCGGACGATTTGCCATTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.18 |
100 |
0.685 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
47.977 |
100 |
0.568 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.377 |
72.603 |
0.438 |
| ssbA | Streptococcus mutans UA159 |
41.096 |
100 |
0.411 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
51.402 |
73.288 |
0.377 |