NTDB

Overview

Name	comA	Type	Regulator
Locus tag	Q6384_RS02560	Genome accession	NZ_CP130890
Coordinates	471341..471622 (-)	Length	93 a.a.
NCBI ID	WP_003696701.1	Uniprot ID	A0A0H4IVZ5
Organism	Neisseria gonorrhoeae strain NJ208756
Function	processing and transport of ComC (predicted from homology) Competence regulation

Genomic Context

Location: 466341..476622

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
Q6384_RS02525 (Q6384_02525)	-	466607..467245 (-)	639	WP_103195245.1	7-carboxy-7-deazaguanine synthase QueE	-
Q6384_RS02530 (Q6384_02530)	-	467242..467610 (-)	369	WP_003690592.1	DUF1304 domain-containing protein	-
Q6384_RS02535 (Q6384_02535)	queD	467881..468315 (-)	435	WP_003690591.1	6-carboxytetrahydropterin synthase QueD	-
Q6384_RS02540 (Q6384_02540)	-	468403..468918 (-)	516	WP_003687408.1	DUF1543 domain-containing protein	-
Q6384_RS02545 (Q6384_02545)	queC	468946..469605 (-)	660	WP_003690590.1	7-cyano-7-deazaguanine synthase QueC	-
Q6384_RS02550 (Q6384_02550)	-	469790..469995 (-)	206	Protein_496	NAD(P)H-quinone oxidoreductase	-
Q6384_RS02555 (Q6384_02555)	-	470094..471320 (+)	1227	WP_003690589.1	YihY family inner membrane protein	-
Q6384_RS02560 (Q6384_02560)	comA	471341..471622 (-)	282	WP_003696701.1	ATP-binding cassette domain-containing protein	Regulator
Q6384_RS02565 (Q6384_02565)	-	471701..471817 (+)	117	Protein_499	IS5/IS1182 family transposase	-
Q6384_RS02570 (Q6384_02570)	-	471815..472045 (-)	231	WP_225577429.1	ATP-binding cassette domain-containing protein	-
Q6384_RS02575 (Q6384_02575)	-	472031..472582 (-)	552	Protein_501	cysteine peptidase family C39 domain-containing protein	-
Q6384_RS02580 (Q6384_02580)	-	472684..472899 (-)	216	WP_003687400.1	hypothetical protein	-
Q6384_RS02585 (Q6384_02585)	-	472913..473260 (-)	348	WP_003687399.1	hypothetical protein	-
Q6384_RS02590 (Q6384_02590)	-	473445..474719 (-)	1275	WP_003698048.1	HlyD family secretion protein	-
Q6384_RS02595 (Q6384_02595)	-	474780..475052 (-)	273	WP_226888059.1	hypothetical protein	-
Q6384_RS02600 (Q6384_02600)	-	475127..475353 (-)	227	Protein_506	hypothetical protein	-
Q6384_RS02605 (Q6384_02605)	-	475362..476516 (-)	1155	WP_010359759.1	cupin domain-containing protein	-

Sequence

Protein

Download Length: 93 a.a. Molecular weight: 10117.78 Da Isoelectric Point: 6.4598

                                >NTDB_id=787995 Q6384_RS02560 WP_003696701.1 471341..471622(-) (comA) [Neisseria gonorrhoeae strain NJ208756]

MIREEISAMPMGYETLIGDMGSALSGGQKQRIVLARALYCEPKILFLDEAASHLDIANEKAVNANLNGLSIIKIMAAHRK

ETVESADRKMSLG

Nucleotide

Download Length: 282 bp

                                >NTDB_id=787995 Q6384_RS02560 WP_003696701.1 471341..471622(-) (comA) [Neisseria gonorrhoeae strain NJ208756]

ATGATTCGCGAAGAAATCTCCGCCATGCCTATGGGCTATGAAACCTTGATCGGCGATATGGGCAGCGCACTGTCAGGCGG

ACAAAAACAACGTATCGTATTGGCGCGGGCCTTATATTGCGAACCGAAAATCCTATTTTTAGATGAAGCGGCCAGTCATT

TGGATATTGCCAATGAAAAAGCAGTCAATGCAAACTTGAATGGCTTGTCTATTATAAAAATTATGGCGGCACACAGAAAG

GAAACGGTGGAATCAGCAGATAGGAAAATGTCTTTAGGATAA

Domains

Predicted by InterProScan.

ABC transporter (ABC_tran)

(14-51)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A0H4IVZ5

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comA	Streptococcus mitis SK321	46.154	97.849	0.452
comA	Streptococcus mitis NCTC 12261	45.055	97.849	0.441
comA	Streptococcus pneumoniae TIGR4	45.055	97.849	0.441
comA	Streptococcus pneumoniae Rx1	45.055	97.849	0.441
comA	Streptococcus pneumoniae R6	45.055	97.849	0.441
comA	Streptococcus pneumoniae D39	45.055	97.849	0.441
comA/nlmT	Streptococcus mutans UA159	47.126	93.548	0.441
comA	Streptococcus gordonii str. Challis substr. CH1	43.956	97.849	0.43

Detailed information NTG0787995