Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   PPK11_RS05185 Genome accession   NZ_CP117024
Coordinates   1099311..1099424 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain 444A6     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1094311..1104424
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PPK11_RS05165 - 1094974..1096386 (-) 1413 WP_273896142.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  PPK11_RS05170 comB10 1096456..1097592 (-) 1137 WP_273896143.1 DNA type IV secretion system protein ComB10 Machinery gene
  PPK11_RS05175 comB9 1097585..1098571 (-) 987 WP_273896144.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  PPK11_RS05180 comB8 1098571..1099314 (-) 744 WP_273896145.1 type IV secretion system protein Machinery gene
  PPK11_RS05185 comB7 1099311..1099424 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  PPK11_RS05190 comB6 1099440..1100495 (-) 1056 WP_273899228.1 P-type conjugative transfer protein TrbL Machinery gene
  PPK11_RS05195 - 1100503..1101498 (-) 996 WP_273896180.1 PDZ domain-containing protein -
  PPK11_RS05200 - 1101498..1101800 (-) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  PPK11_RS05205 panD 1101803..1102156 (-) 354 WP_273896204.1 aspartate 1-decarboxylase -
  PPK11_RS05210 - 1102146..1104371 (-) 2226 WP_273896205.1 AAA family ATPase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=782074 PPK11_RS05185 WP_001217873.1 1099311..1099424(-) (comB7) [Helicobacter pylori strain 444A6]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=782074 PPK11_RS05185 WP_001217873.1 1099311..1099424(-) (comB7) [Helicobacter pylori strain 444A6]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1