Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   G7Y72_RS12325 Genome accession   NZ_AP022371
Coordinates   2642011..2642472 (+) Length   153 a.a.
NCBI ID   WP_164561137.1    Uniprot ID   -
Organism   Providencia rettgeri strain BML2496     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2606012..2648009 2642011..2642472 within 0


Gene organization within MGE regions


Location: 2606012..2648009
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G7Y72_RS12040 (BML2496_23710) - 2606012..2607181 (+) 1170 WP_164561096.1 tyrosine-type recombinase/integrase -
  G7Y72_RS21725 (BML2496_23720) - 2607246..2609531 (-) 2286 WP_232062895.1 phage head-binding domain-containing protein -
  G7Y72_RS12050 (BML2496_23730) - 2609646..2609906 (+) 261 WP_164561097.1 Arc family DNA-binding protein -
  G7Y72_RS12055 (BML2496_23740) - 2609922..2610413 (-) 492 WP_164561098.1 hypothetical protein -
  G7Y72_RS12060 (BML2496_23750) - 2610410..2610610 (-) 201 WP_164561099.1 hypothetical protein -
  G7Y72_RS12065 (BML2496_23760) - 2610841..2611248 (+) 408 WP_164561100.1 hypothetical protein -
  G7Y72_RS12070 (BML2496_23770) - 2611245..2613209 (-) 1965 WP_164561101.1 hypothetical protein -
  G7Y72_RS12075 (BML2496_23780) - 2613221..2614690 (-) 1470 WP_164561102.1 phage DNA ejection protein -
  G7Y72_RS12080 (BML2496_23790) - 2614690..2615385 (-) 696 WP_164561306.1 DNA transfer protein -
  G7Y72_RS12085 (BML2496_23800) - 2615403..2615852 (-) 450 WP_048606466.1 DUF2824 family protein -
  G7Y72_RS12090 (BML2496_23810) - 2615860..2616489 (-) 630 WP_232062896.1 phage tail protein -
  G7Y72_RS22100 (BML2496_23820) - 2616594..2618387 (-) 1794 WP_336431423.1 packaged DNA stabilization protein -
  G7Y72_RS12105 (BML2496_23830) - 2618359..2618856 (-) 498 WP_164561104.1 packaged DNA stabilization gp4 family protein -
  G7Y72_RS12110 (BML2496_23840) - 2618834..2619037 (-) 204 WP_164561105.1 hypothetical protein -
  G7Y72_RS12115 (BML2496_23850) - 2619094..2620377 (-) 1284 WP_164561106.1 P22 phage major capsid protein family protein -
  G7Y72_RS12120 (BML2496_23860) - 2620377..2621291 (-) 915 WP_164561107.1 scaffolding protein -
  G7Y72_RS12125 (BML2496_23870) - 2621306..2623396 (-) 2091 WP_164561108.1 portal protein -
  G7Y72_RS12130 (BML2496_23880) - 2623399..2624718 (-) 1320 WP_232062975.1 terminase large subunit -
  G7Y72_RS12135 (BML2496_23890) - 2624870..2625361 (-) 492 WP_164561110.1 DNA-packaging protein -
  G7Y72_RS12140 (BML2496_23900) - 2625416..2625643 (-) 228 WP_036964249.1 DUF2560 family protein -
  G7Y72_RS12145 (BML2496_23910) - 2625688..2626224 (-) 537 WP_164561111.1 Rha family transcriptional regulator -
  G7Y72_RS22105 - 2626372..2626677 (+) 306 WP_164561112.1 hypothetical protein -
  G7Y72_RS22110 (BML2496_23920) - 2626635..2627030 (-) 396 WP_164561113.1 hypothetical protein -
  G7Y72_RS12160 (BML2496_23930) - 2627032..2627364 (-) 333 WP_004918418.1 M15 family metallopeptidase -
  G7Y72_RS12165 (BML2496_23940) - 2627361..2627696 (-) 336 WP_164561114.1 phage holin, lambda family -
  G7Y72_RS12170 (BML2496_23950) - 2627939..2628187 (+) 249 WP_096864266.1 hypothetical protein -
  G7Y72_RS12175 - 2628196..2628372 (+) 177 WP_141395908.1 helix-turn-helix domain-containing protein -
  G7Y72_RS12180 (BML2496_23960) - 2628624..2629211 (-) 588 WP_226693966.1 hypothetical protein -
  G7Y72_RS12185 (BML2496_23970) - 2629208..2629399 (-) 192 WP_096864267.1 protein ninH -
  G7Y72_RS12190 (BML2496_23980) - 2629389..2629754 (-) 366 WP_164561115.1 RusA family crossover junction endodeoxyribonuclease -
  G7Y72_RS12195 (BML2496_23990) - 2629751..2630041 (-) 291 WP_164561116.1 DUF1364 domain-containing protein -
  G7Y72_RS12200 (BML2496_24000) - 2630102..2630764 (-) 663 WP_164561117.1 metallophosphoesterase -
  G7Y72_RS12205 (BML2496_24010) - 2630761..2631135 (-) 375 WP_164561118.1 hypothetical protein -
  G7Y72_RS12210 (BML2496_24020) - 2631424..2631606 (-) 183 WP_164561119.1 hypothetical protein -
  G7Y72_RS12215 (BML2496_24030) - 2631617..2632063 (-) 447 WP_164561120.1 DUF1367 family protein -
  G7Y72_RS12220 (BML2496_24040) - 2632073..2632381 (-) 309 WP_164561121.1 hypothetical protein -
  G7Y72_RS12225 (BML2496_24050) - 2632378..2632614 (-) 237 WP_164561122.1 DUF551 domain-containing protein -
  G7Y72_RS12230 (BML2496_24060) - 2632601..2632924 (-) 324 WP_164561123.1 hypothetical protein -
  G7Y72_RS12235 (BML2496_24070) - 2632935..2633138 (-) 204 WP_105881150.1 hypothetical protein -
  G7Y72_RS12240 (BML2496_24080) - 2633164..2634018 (-) 855 WP_164561124.1 ATP-binding protein -
  G7Y72_RS12245 (BML2496_24090) - 2634022..2634831 (-) 810 WP_164561125.1 hypothetical protein -
  G7Y72_RS12250 (BML2496_24100) - 2634809..2635522 (-) 714 WP_164561126.1 GIY-YIG nuclease family protein -
  G7Y72_RS12255 (BML2496_24110) - 2635548..2635865 (-) 318 WP_164561127.1 CII family transcriptional regulator -
  G7Y72_RS12260 (BML2496_24120) - 2635976..2636194 (-) 219 WP_126437312.1 YdaS family helix-turn-helix protein -
  G7Y72_RS12265 (BML2496_24130) - 2636302..2637030 (+) 729 WP_232062897.1 helix-turn-helix transcriptional regulator -
  G7Y72_RS12270 (BML2496_24140) - 2637071..2637277 (-) 207 WP_164561128.1 hypothetical protein -
  G7Y72_RS12275 (BML2496_24160) - 2637841..2638407 (+) 567 WP_164561129.1 hypothetical protein -
  G7Y72_RS22115 (BML2496_24170) - 2638466..2638633 (+) 168 WP_164561130.1 hypothetical protein -
  G7Y72_RS22120 (BML2496_24180) - 2638661..2639005 (+) 345 WP_164561131.1 hypothetical protein -
  G7Y72_RS12290 (BML2496_24190) - 2639009..2639302 (+) 294 WP_164561132.1 hypothetical protein -
  G7Y72_RS12295 (BML2496_24200) - 2639331..2639540 (+) 210 WP_164561133.1 hypothetical protein -
  G7Y72_RS12300 (BML2496_24210) - 2639530..2639811 (+) 282 WP_164561134.1 hypothetical protein -
  G7Y72_RS12305 (BML2496_24230) - 2640015..2640191 (+) 177 WP_164561135.1 hypothetical protein -
  G7Y72_RS12310 (BML2496_24240) - 2640201..2640407 (+) 207 WP_131681031.1 hypothetical protein -
  G7Y72_RS12315 (BML2496_24250) - 2640404..2641222 (+) 819 WP_164561136.1 PD-(D/E)XK nuclease-like domain-containing protein -
  G7Y72_RS12320 (BML2496_24260) recT 2641215..2642018 (+) 804 WP_131681033.1 recombination protein RecT -
  G7Y72_RS12325 (BML2496_24270) ssb 2642011..2642472 (+) 462 WP_164561137.1 single-stranded DNA-binding protein Machinery gene
  G7Y72_RS12330 (BML2496_24280) - 2642543..2642746 (+) 204 WP_232062898.1 hook protein -
  G7Y72_RS12335 (BML2496_24290) - 2643029..2643319 (+) 291 WP_164561138.1 hypothetical protein -
  G7Y72_RS12340 (BML2496_24300) - 2643316..2643489 (+) 174 WP_164561139.1 hypothetical protein -
  G7Y72_RS12345 (BML2496_24310) - 2643489..2643710 (+) 222 WP_060561227.1 hypothetical protein -
  G7Y72_RS12350 (BML2496_24320) - 2643710..2644063 (+) 354 WP_164561140.1 hypothetical protein -
  G7Y72_RS12355 (BML2496_24330) - 2644480..2644776 (+) 297 WP_164561141.1 hypothetical protein -
  G7Y72_RS12360 (BML2496_24340) - 2644776..2644949 (+) 174 WP_164561142.1 hypothetical protein -
  G7Y72_RS12365 (BML2496_24350) - 2644942..2645331 (+) 390 WP_164561143.1 phage protein NinX family protein -
  G7Y72_RS12370 - 2645512..2645718 (+) 207 WP_154633740.1 DUF4060 family protein -
  G7Y72_RS12375 (BML2496_24370) - 2645715..2645942 (+) 228 WP_164561144.1 hypothetical protein -
  G7Y72_RS21730 (BML2496_24380) - 2645932..2646138 (+) 207 WP_232062899.1 AlpA family phage regulatory protein -
  G7Y72_RS12380 - 2646585..2646755 (-) 171 WP_164561145.1 hypothetical protein -
  G7Y72_RS12385 (BML2496_24400) - 2646985..2647491 (-) 507 WP_004264847.1 AAA family ATPase -
  G7Y72_RS12390 (BML2496_24410) - 2647587..2648009 (-) 423 WP_096864906.1 GNAT family N-acetyltransferase -

Sequence

Protein


Download         Length: 153 a.a.        Molecular weight: 16957.95 Da        Isoelectric Point: 5.7586

>NTDB_id=77909 G7Y72_RS12325 WP_164561137.1 2642011..2642472(+) (ssb) [Providencia rettgeri strain BML2496]
MASRGVNKVILVGNLGQDVEMRYMPNGGAVANLTLATSETWRDKQSGEMREKTEWHRVIIFGKLAEVAGEYLKKGSQVYI
EGSLQTRKWQDQSGQDRYTTEVLVNVGGAMQMLGGNGGNNQTGSQQPARQPQQPHQAPQNEPPMDWESDPIPF

Nucleotide


Download         Length: 462 bp        

>NTDB_id=77909 G7Y72_RS12325 WP_164561137.1 2642011..2642472(+) (ssb) [Providencia rettgeri strain BML2496]
ATGGCTAGTCGCGGAGTGAATAAGGTCATACTTGTTGGAAATTTGGGTCAAGATGTCGAAATGCGCTACATGCCTAACGG
TGGCGCAGTAGCAAATCTCACACTAGCCACATCGGAAACATGGCGTGATAAACAATCAGGTGAGATGCGCGAAAAAACCG
AATGGCATCGAGTTATAATTTTCGGCAAGTTAGCTGAAGTTGCAGGTGAATATCTGAAAAAAGGCTCACAAGTCTATATC
GAAGGTTCTTTGCAAACGCGTAAATGGCAAGACCAAAGCGGTCAAGACCGATACACAACGGAAGTGCTAGTAAATGTCGG
TGGCGCGATGCAAATGCTAGGCGGTAACGGTGGCAATAATCAGACAGGAAGCCAGCAACCAGCGCGGCAACCTCAGCAGC
CACATCAAGCGCCGCAGAATGAGCCACCGATGGATTGGGAAAGCGACCCAATACCCTTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-112)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

66.854

100

0.778
  ssb Glaesserella parasuis strain SC1401

52.486

100

0.621
  ssb Neisseria meningitidis MC58

42.614

100

0.49
  ssb Neisseria gonorrhoeae MS11

42.614

100

0.49
  ssb Latilactobacillus sakei subsp. sakei 23K

32

100

0.366

Multiple sequence alignment