Detailed information
Overview
| Name | comGD/cglD | Type | Machinery gene |
| Locus tag | OTU45_RS10805 | Genome accession | NZ_CP113114 |
| Coordinates | 2095272..2095676 (-) | Length | 134 a.a. |
| NCBI ID | WP_000588013.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain NP1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2096426..2134772 | 2095272..2095676 | flank | 750 |
Gene organization within MGE regions
Location: 2095272..2134772
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OTU45_RS10805 (OTU45_10805) | comGD/cglD | 2095272..2095676 (-) | 405 | WP_000588013.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| OTU45_RS10810 (OTU45_10810) | comGC/cglC | 2095669..2095935 (-) | 267 | WP_050073122.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| OTU45_RS10815 (OTU45_10815) | - | 2095937..2096194 (-) | 258 | WP_000698513.1 | hypothetical protein | - |
| OTU45_RS10820 (OTU45_10820) | lytA | 2096426..2097382 (-) | 957 | WP_054436120.1 | N-acetylmuramoyl-L-alanine amidase LytA | - |
| OTU45_RS10825 (OTU45_10825) | - | 2097382..2097717 (-) | 336 | WP_001186204.1 | phage holin | - |
| OTU45_RS10830 (OTU45_10830) | - | 2097721..2098020 (-) | 300 | WP_001811580.1 | hypothetical protein | - |
| OTU45_RS10835 (OTU45_10835) | - | 2098030..2098380 (-) | 351 | WP_054368148.1 | hypothetical protein | - |
| OTU45_RS10840 (OTU45_10840) | - | 2098383..2098586 (-) | 204 | WP_001091107.1 | hypothetical protein | - |
| OTU45_RS10845 (OTU45_10845) | - | 2098567..2098683 (-) | 117 | WP_001063632.1 | hypothetical protein | - |
| OTU45_RS10850 (OTU45_10850) | - | 2098680..2106629 (-) | 7950 | WP_267747982.1 | phage tail spike protein | - |
| OTU45_RS10855 (OTU45_10855) | - | 2106626..2107324 (-) | 699 | WP_000499607.1 | adenylosuccinate synthetase | - |
| OTU45_RS10860 (OTU45_10860) | - | 2107324..2109789 (-) | 2466 | WP_050228208.1 | hypothetical protein | - |
| OTU45_RS10865 (OTU45_10865) | - | 2109789..2110175 (-) | 387 | WP_000560880.1 | DUF5361 domain-containing protein | - |
| OTU45_RS10870 (OTU45_10870) | - | 2110187..2110462 (-) | 276 | WP_000391234.1 | hypothetical protein | - |
| OTU45_RS10875 (OTU45_10875) | - | 2110468..2111025 (-) | 558 | WP_050254374.1 | hypothetical protein | - |
| OTU45_RS10880 (OTU45_10880) | - | 2111092..2111427 (-) | 336 | WP_000571659.1 | hypothetical protein | - |
| OTU45_RS10885 (OTU45_10885) | - | 2111424..2111660 (-) | 237 | WP_000069060.1 | hypothetical protein | - |
| OTU45_RS10890 (OTU45_10890) | - | 2111653..2111991 (-) | 339 | WP_000221695.1 | hypothetical protein | - |
| OTU45_RS10895 (OTU45_10895) | - | 2111936..2112376 (-) | 441 | WP_267748001.1 | phage Gp19/Gp15/Gp42 family protein | - |
| OTU45_RS10900 (OTU45_10900) | - | 2112380..2112592 (-) | 213 | WP_001240369.1 | HeH/LEM domain-containing protein | - |
| OTU45_RS10905 (OTU45_10905) | - | 2112598..2113497 (-) | 900 | WP_267748004.1 | phage major capsid protein | - |
| OTU45_RS10910 (OTU45_10910) | - | 2113503..2113967 (-) | 465 | WP_050254365.1 | DUF4355 domain-containing protein | - |
| OTU45_RS10915 (OTU45_10915) | - | 2114049..2115461 (-) | 1413 | WP_267748008.1 | DEAD/DEAH box helicase family protein | - |
| OTU45_RS10920 (OTU45_10920) | - | 2115512..2115742 (-) | 231 | WP_050254363.1 | hypothetical protein | - |
| OTU45_RS10925 (OTU45_10925) | - | 2115792..2116019 (-) | 228 | WP_050254362.1 | hypothetical protein | - |
| OTU45_RS10930 (OTU45_10930) | - | 2116006..2117241 (-) | 1236 | WP_267748011.1 | hypothetical protein | - |
| OTU45_RS10935 (OTU45_10935) | - | 2117195..2118499 (-) | 1305 | WP_267748013.1 | hypothetical protein | - |
| OTU45_RS10940 (OTU45_10940) | - | 2118636..2118980 (-) | 345 | WP_001095652.1 | HNH endonuclease | - |
| OTU45_RS10945 (OTU45_10945) | - | 2119214..2119780 (-) | 567 | WP_061634575.1 | site-specific integrase | - |
| OTU45_RS10950 (OTU45_10950) | - | 2120070..2120498 (-) | 429 | WP_050216380.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| OTU45_RS10955 (OTU45_10955) | - | 2120511..2120699 (-) | 189 | WP_050240803.1 | multiprotein-bridging factor 1 family protein | - |
| OTU45_RS10960 (OTU45_10960) | - | 2120692..2120868 (-) | 177 | WP_000005959.1 | hypothetical protein | - |
| OTU45_RS10965 (OTU45_10965) | - | 2120861..2121097 (-) | 237 | WP_001067627.1 | DUF3310 domain-containing protein | - |
| OTU45_RS10970 (OTU45_10970) | - | 2121113..2121634 (-) | 522 | WP_050254359.1 | YopX family protein | - |
| OTU45_RS10975 (OTU45_10975) | - | 2121646..2121924 (-) | 279 | WP_001813036.1 | hypothetical protein | - |
| OTU45_RS10980 (OTU45_10980) | - | 2122006..2122292 (-) | 287 | Protein_2147 | hypothetical protein | - |
| OTU45_RS10985 (OTU45_10985) | - | 2122276..2122878 (-) | 603 | WP_050254358.1 | DUF1642 domain-containing protein | - |
| OTU45_RS10990 (OTU45_10990) | - | 2122871..2123371 (-) | 501 | WP_001041165.1 | DUF1642 domain-containing protein | - |
| OTU45_RS10995 (OTU45_10995) | - | 2123373..2123690 (-) | 318 | WP_180372348.1 | hypothetical protein | - |
| OTU45_RS11000 (OTU45_11000) | - | 2123662..2123871 (-) | 210 | WP_000872731.1 | hypothetical protein | - |
| OTU45_RS11005 (OTU45_11005) | - | 2123858..2124025 (-) | 168 | WP_267748031.1 | hypothetical protein | - |
| OTU45_RS11010 (OTU45_11010) | - | 2124116..2124421 (-) | 306 | WP_001097109.1 | hypothetical protein | - |
| OTU45_RS11015 (OTU45_11015) | - | 2124421..2124639 (-) | 219 | WP_000891962.1 | hypothetical protein | - |
| OTU45_RS11020 (OTU45_11020) | - | 2124639..2124833 (-) | 195 | WP_000470303.1 | hypothetical protein | - |
| OTU45_RS11025 (OTU45_11025) | - | 2124848..2125618 (-) | 771 | WP_000228210.1 | ATP-binding protein | - |
| OTU45_RS11030 (OTU45_11030) | - | 2125612..2125770 (-) | 159 | WP_000511761.1 | hypothetical protein | - |
| OTU45_RS11035 (OTU45_11035) | - | 2125758..2126564 (-) | 807 | WP_267748048.1 | phage replisome organizer N-terminal domain-containing protein | - |
| OTU45_RS11040 (OTU45_11040) | - | 2126557..2126853 (-) | 297 | WP_000391807.1 | hypothetical protein | - |
| OTU45_RS11045 (OTU45_11045) | - | 2126869..2127189 (-) | 321 | WP_000462831.1 | hypothetical protein | - |
| OTU45_RS11050 (OTU45_11050) | - | 2127275..2127397 (-) | 123 | Protein_2161 | DNA-binding protein | - |
| OTU45_RS11055 (OTU45_11055) | - | 2127401..2127559 (-) | 159 | WP_180384356.1 | BOW99_gp33 family protein | - |
| OTU45_RS11060 (OTU45_11060) | - | 2127631..2128347 (-) | 717 | WP_001004043.1 | phage antirepressor KilAC domain-containing protein | - |
| OTU45_RS11065 (OTU45_11065) | - | 2128371..2128574 (-) | 204 | WP_001247820.1 | hypothetical protein | - |
| OTU45_RS11070 (OTU45_11070) | - | 2129228..2129416 (-) | 189 | WP_001161207.1 | helix-turn-helix transcriptional regulator | - |
| OTU45_RS11075 (OTU45_11075) | - | 2129608..2129898 (-) | 291 | WP_001815531.1 | hypothetical protein | - |
| OTU45_RS11080 (OTU45_11080) | - | 2130097..2130546 (+) | 450 | WP_001058908.1 | hypothetical protein | - |
| OTU45_RS11085 (OTU45_11085) | - | 2130537..2130704 (-) | 168 | WP_267748061.1 | hypothetical protein | - |
| OTU45_RS11090 (OTU45_11090) | - | 2130779..2131054 (-) | 276 | WP_001094375.1 | hypothetical protein | - |
| OTU45_RS11095 (OTU45_11095) | - | 2131209..2131997 (+) | 789 | WP_050116194.1 | helix-turn-helix domain-containing protein | - |
| OTU45_RS11100 (OTU45_11100) | - | 2131999..2132199 (+) | 201 | WP_000064302.1 | hypothetical protein | - |
| OTU45_RS11105 (OTU45_11105) | - | 2132373..2133818 (+) | 1446 | WP_267748066.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 134 a.a. Molecular weight: 14665.85 Da Isoelectric Point: 10.2164
>NTDB_id=760374 OTU45_RS10805 WP_000588013.1 2095272..2095676(-) (comGD/cglD) [Streptococcus pneumoniae strain NP1]
MIKAFTMLESLLVLGLVSILALGLSGSVQSTFAAVEEQIFFMEFEELYRETQKRSVASQQKTNLNLDGQTLSNGSQKLTV
PKGIQAPSGQSITFDRAGGNSSLAKVEFQTSKGAIRYQLYLGNGKIKRIKETKN
MIKAFTMLESLLVLGLVSILALGLSGSVQSTFAAVEEQIFFMEFEELYRETQKRSVASQQKTNLNLDGQTLSNGSQKLTV
PKGIQAPSGQSITFDRAGGNSSLAKVEFQTSKGAIRYQLYLGNGKIKRIKETKN
Nucleotide
Download Length: 405 bp
>NTDB_id=760374 OTU45_RS10805 WP_000588013.1 2095272..2095676(-) (comGD/cglD) [Streptococcus pneumoniae strain NP1]
ATGATTAAGGCCTTTACCATGCTGGAAAGTCTCTTGGTTTTGGGTCTTGTGAGTATCCTTGCCTTGGGCTTGTCCGGCTC
TGTTCAGTCCACTTTTGCGGCGGTAGAGGAACAGATTTTCTTTATGGAGTTTGAAGAACTCTATCGGGAAACCCAAAAAC
GCAGTGTAGCCAGTCAGCAAAAGACTAATCTAAATTTAGATGGGCAGACGCTTAGCAATGGCAGTCAAAAGTTGACAGTT
CCTAAAGGAATTCAGGCACCATCAGGCCAAAGTATTACATTTGACCGAGCTGGGGGCAATTCGTCCCTGGCTAAGGTTGA
ATTTCAGACCAGTAAAGGAGCGATTCGCTATCAATTATATCTAGGAAATGGAAAAATTAAACGCATTAAGGAAACAAAAA
ATTAG
ATGATTAAGGCCTTTACCATGCTGGAAAGTCTCTTGGTTTTGGGTCTTGTGAGTATCCTTGCCTTGGGCTTGTCCGGCTC
TGTTCAGTCCACTTTTGCGGCGGTAGAGGAACAGATTTTCTTTATGGAGTTTGAAGAACTCTATCGGGAAACCCAAAAAC
GCAGTGTAGCCAGTCAGCAAAAGACTAATCTAAATTTAGATGGGCAGACGCTTAGCAATGGCAGTCAAAAGTTGACAGTT
CCTAAAGGAATTCAGGCACCATCAGGCCAAAGTATTACATTTGACCGAGCTGGGGGCAATTCGTCCCTGGCTAAGGTTGA
ATTTCAGACCAGTAAAGGAGCGATTCGCTATCAATTATATCTAGGAAATGGAAAAATTAAACGCATTAAGGAAACAAAAA
ATTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD/cglD | Streptococcus pneumoniae TIGR4 |
97.761 |
100 |
0.978 |
| comGD/cglD | Streptococcus pneumoniae Rx1 |
97.015 |
100 |
0.97 |
| comGD/cglD | Streptococcus pneumoniae D39 |
97.015 |
100 |
0.97 |
| comGD/cglD | Streptococcus pneumoniae R6 |
97.015 |
100 |
0.97 |
| comGD/cglD | Streptococcus mitis SK321 |
96.269 |
100 |
0.963 |
| comGD/cglD | Streptococcus mitis NCTC 12261 |
96.992 |
99.254 |
0.963 |
| comYD | Streptococcus gordonii str. Challis substr. CH1 |
58.268 |
94.776 |
0.552 |
| comYD | Streptococcus mutans UA140 |
49.219 |
95.522 |
0.47 |
| comYD | Streptococcus mutans UA159 |
49.219 |
95.522 |
0.47 |