Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   OMK57_RS12695 Genome accession   NZ_CP110264
Coordinates   2552134..2552481 (-) Length   115 a.a.
NCBI ID   WP_069487185.1    Uniprot ID   -
Organism   Bacillus halotolerans strain HMB20199     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2547134..2557481
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OMK57_RS12650 (OMK57_12650) sinI 2547661..2547834 (+) 174 WP_024122036.1 anti-repressor SinI Regulator
  OMK57_RS12655 (OMK57_12655) sinR 2547868..2548203 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  OMK57_RS12660 (OMK57_12660) tasA 2548289..2549074 (-) 786 WP_059293609.1 biofilm matrix protein TasA -
  OMK57_RS12665 (OMK57_12665) sipW 2549139..2549723 (-) 585 WP_059293608.1 signal peptidase I SipW -
  OMK57_RS12670 (OMK57_12670) tapA 2549695..2550456 (-) 762 WP_069487187.1 amyloid fiber anchoring/assembly protein TapA -
  OMK57_RS12675 (OMK57_12675) - 2550733..2551056 (+) 324 WP_024122040.1 YqzG/YhdC family protein -
  OMK57_RS12680 (OMK57_12680) - 2551099..2551278 (-) 180 WP_003236949.1 YqzE family protein -
  OMK57_RS12685 (OMK57_12685) comGG 2551350..2551724 (-) 375 WP_059335411.1 competence type IV pilus minor pilin ComGG Machinery gene
  OMK57_RS12690 (OMK57_12690) comGF 2551725..2552108 (-) 384 WP_175422400.1 competence type IV pilus minor pilin ComGF Machinery gene
  OMK57_RS12695 (OMK57_12695) comGE 2552134..2552481 (-) 348 WP_069487185.1 competence type IV pilus minor pilin ComGE Machinery gene
  OMK57_RS12700 (OMK57_12700) comGD 2552465..2552896 (-) 432 WP_044154579.1 competence type IV pilus minor pilin ComGD Machinery gene
  OMK57_RS12705 (OMK57_12705) comGC 2552886..2553182 (-) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  OMK57_RS12710 (OMK57_12710) comGB 2553196..2554233 (-) 1038 WP_059293603.1 competence type IV pilus assembly protein ComGB Machinery gene
  OMK57_RS12715 (OMK57_12715) comGA 2554220..2555290 (-) 1071 WP_264797940.1 competence protein ComGA Machinery gene
  OMK57_RS12720 (OMK57_12720) - 2555612..2556022 (-) 411 WP_059293601.1 CBS domain-containing protein -
  OMK57_RS12725 (OMK57_12725) corA 2556085..2557038 (-) 954 WP_044154576.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13218.10 Da        Isoelectric Point: 4.4620

>NTDB_id=753570 OMK57_RS12695 WP_069487185.1 2552134..2552481(-) (comGE) [Bacillus halotolerans strain HMB20199]
MWRENKGFSTIETMAALSIWLFMLLTIVPLWNKLIADEHIAESREIGYQLVNESIGKYMLIGAGNSSQAVSMNNSKYSMT
WEEEGEYQNVCISSDTYKDKPFCLSILRTDWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=753570 OMK57_RS12695 WP_069487185.1 2552134..2552481(-) (comGE) [Bacillus halotolerans strain HMB20199]
ATGTGGAGAGAAAATAAAGGCTTTTCTACAATTGAAACAATGGCTGCCCTCAGCATATGGCTGTTTATGCTTCTGACGAT
CGTGCCGTTGTGGAACAAGCTGATAGCTGATGAACATATAGCGGAGTCGAGAGAAATTGGTTATCAGCTTGTTAATGAAA
GCATAGGCAAATATATGCTGATAGGAGCAGGAAATTCGTCACAGGCTGTTTCGATGAACAATAGCAAATACTCGATGACA
TGGGAGGAGGAGGGAGAGTATCAAAACGTATGCATCTCATCAGACACCTATAAAGACAAGCCATTTTGCCTCAGCATTTT
GCGGACAGACTGGCTATACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

69.565

100

0.696