Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   QA712_RS06865 Genome accession   NZ_CP121539
Coordinates   1249518..1249802 (-) Length   94 a.a.
NCBI ID   WP_311802844.1    Uniprot ID   -
Organism   Lactococcus lactis strain MA5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1244518..1254802
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QA712_RS06835 (QA712_06835) - 1244959..1245336 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  QA712_RS06840 (QA712_06840) - 1245541..1246407 (+) 867 WP_332529355.1 RluA family pseudouridine synthase -
  QA712_RS06845 (QA712_06845) - 1246445..1247254 (-) 810 WP_014570791.1 metal ABC transporter permease -
  QA712_RS06850 (QA712_06850) - 1247247..1247984 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  QA712_RS06855 (QA712_06855) - 1248161..1249003 (-) 843 WP_311920327.1 metal ABC transporter substrate-binding protein -
  QA712_RS06860 (QA712_06860) - 1249000..1249437 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  QA712_RS06865 (QA712_06865) comGG 1249518..1249802 (-) 285 WP_311802844.1 competence type IV pilus minor pilin ComGG Machinery gene
  QA712_RS06870 (QA712_06870) comGF 1249841..1250287 (-) 447 WP_195935889.1 competence type IV pilus minor pilin ComGF Machinery gene
  QA712_RS06875 (QA712_06875) comGE 1250250..1250546 (-) 297 WP_332529356.1 competence type IV pilus minor pilin ComGE Machinery gene
  QA712_RS06880 (QA712_06880) comGD 1250518..1250949 (-) 432 WP_195935890.1 competence type IV pilus minor pilin ComGD Machinery gene
  QA712_RS06885 (QA712_06885) comGC 1250909..1251178 (-) 270 WP_021721869.1 competence type IV pilus major pilin ComGC Machinery gene
  QA712_RS06890 (QA712_06890) comGB 1251306..1252380 (-) 1075 Protein_1223 competence type IV pilus assembly protein ComGB -
  QA712_RS06895 (QA712_06895) comGA 1252274..1253212 (-) 939 WP_195935891.1 competence type IV pilus ATPase ComGA Machinery gene
  QA712_RS06900 (QA712_06900) - 1253481..1253663 (-) 183 WP_047206975.1 hypothetical protein -
  QA712_RS06905 (QA712_06905) - 1253654..1254244 (-) 591 WP_052772651.1 hypothetical protein -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10771.01 Da        Isoelectric Point: 5.0346

>NTDB_id=737307 QA712_RS06865 WP_311802844.1 1249518..1249802(-) (comGG) [Lactococcus lactis strain MA5]
MFSMFLQFYLQTQIEDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGTNFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=737307 QA712_RS06865 WP_311802844.1 1249518..1249802(-) (comGG) [Lactococcus lactis strain MA5]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGCAAACACAAATAGAGGATGCTCGACAATTAAGAAGTGAAAAGGAACAGTT
AACTGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCTAGTTCAAAAATTACTGACCACTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCACCTAAAAGATGGCACAAACTTTCAAATAAAAAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

60.215

98.936

0.596