Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | NYR65_RS04660 | Genome accession | NZ_CP103811 |
| Coordinates | 1011375..1011809 (+) | Length | 144 a.a. |
| NCBI ID | WP_005607789.1 | Uniprot ID | - |
| Organism | Actinobacillus equuli subsp. equuli strain CCUG2041 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1006591..1076248 | 1011375..1011809 | within | 0 |
Gene organization within MGE regions
Location: 1006591..1076248
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR65_RS04640 (NYR65_04640) | - | 1007852..1008403 (+) | 552 | WP_005607778.1 | DUF2857 domain-containing protein | - |
| NYR65_RS04645 (NYR65_04645) | - | 1008550..1009749 (+) | 1200 | WP_039197068.1 | STY4528 family pathogenicity island replication protein | - |
| NYR65_RS04650 (NYR65_04650) | - | 1009831..1010589 (+) | 759 | WP_005607783.1 | TIGR03761 family integrating conjugative element protein | - |
| NYR65_RS04655 (NYR65_04655) | - | 1010605..1011072 (+) | 468 | WP_005620769.1 | DUF3158 family protein | - |
| NYR65_RS04660 (NYR65_04660) | ssb | 1011375..1011809 (+) | 435 | WP_005607789.1 | single-stranded DNA-binding protein | Machinery gene |
| NYR65_RS04665 (NYR65_04665) | - | 1011928..1012572 (-) | 645 | WP_039197069.1 | hypothetical protein | - |
| NYR65_RS04670 (NYR65_04670) | - | 1012737..1013234 (+) | 498 | WP_005607794.1 | hypothetical protein | - |
| NYR65_RS04675 (NYR65_04675) | - | 1013387..1015429 (+) | 2043 | WP_005607796.1 | DNA topoisomerase III | - |
| NYR65_RS04680 (NYR65_04680) | - | 1016299..1016748 (+) | 450 | WP_005607798.1 | STY4534 family ICE replication protein | - |
| NYR65_RS04685 (NYR65_04685) | - | 1016827..1017156 (+) | 330 | WP_005607801.1 | hypothetical protein | - |
| NYR65_RS04690 (NYR65_04690) | - | 1017235..1017882 (+) | 648 | WP_005620766.1 | DUF3560 domain-containing protein | - |
| NYR65_RS04695 (NYR65_04695) | - | 1017950..1018309 (+) | 360 | WP_005620763.1 | hypothetical protein | - |
| NYR65_RS04700 (NYR65_04700) | - | 1018464..1019105 (+) | 642 | WP_039197070.1 | PilL N-terminal domain-containing protein | - |
| NYR65_RS04705 (NYR65_04705) | - | 1019105..1019839 (+) | 735 | WP_005620758.1 | TIGR03759 family integrating conjugative element protein | - |
| NYR65_RS04710 (NYR65_04710) | - | 1019818..1020606 (+) | 789 | WP_005620755.1 | hypothetical protein | - |
| NYR65_RS04715 (NYR65_04715) | - | 1020618..1021121 (+) | 504 | WP_005607818.1 | integrating conjugative element protein | - |
| NYR65_RS04720 (NYR65_04720) | traD | 1021121..1023337 (+) | 2217 | WP_039195111.1 | type IV conjugative transfer system coupling protein TraD | - |
| NYR65_RS04725 (NYR65_04725) | - | 1023324..1023677 (+) | 354 | WP_005620752.1 | hypothetical protein | - |
| NYR65_RS04730 (NYR65_04730) | - | 1023674..1024372 (+) | 699 | WP_005607827.1 | TIGR03747 family integrating conjugative element membrane protein | - |
| NYR65_RS04735 (NYR65_04735) | - | 1024389..1024610 (+) | 222 | WP_039195117.1 | hypothetical protein | - |
| NYR65_RS04740 (NYR65_04740) | - | 1024675..1025010 (-) | 336 | WP_005620751.1 | hypothetical protein | - |
| NYR65_RS04745 (NYR65_04745) | - | 1025208..1025534 (+) | 327 | WP_005620750.1 | RAQPRD family integrative conjugative element protein | - |
| NYR65_RS04750 (NYR65_04750) | - | 1025534..1025776 (+) | 243 | WP_039197071.1 | DUF3262 family protein | - |
| NYR65_RS04755 (NYR65_04755) | - | 1025797..1026204 (+) | 408 | WP_039197072.1 | DUF2976 domain-containing protein | - |
| NYR65_RS04760 (NYR65_04760) | - | 1026234..1026605 (+) | 372 | WP_005607834.1 | TIGR03750 family conjugal transfer protein | - |
| NYR65_RS04765 (NYR65_04765) | - | 1026602..1027243 (+) | 642 | WP_005607836.1 | TIGR03746 family integrating conjugative element protein | - |
| NYR65_RS04770 (NYR65_04770) | - | 1027243..1028133 (+) | 891 | WP_005607840.1 | TIGR03749 family integrating conjugative element protein | - |
| NYR65_RS04775 (NYR65_04775) | - | 1028142..1029598 (+) | 1457 | Protein_929 | TIGR03752 family integrating conjugative element protein | - |
| NYR65_RS04780 (NYR65_04780) | - | 1029609..1030007 (+) | 399 | WP_005607846.1 | TIGR03751 family conjugal transfer lipoprotein | - |
| NYR65_RS04785 (NYR65_04785) | - | 1030010..1032820 (+) | 2811 | WP_039197073.1 | conjugative transfer ATPase | - |
| NYR65_RS04790 (NYR65_04790) | - | 1032817..1033248 (+) | 432 | WP_039195126.1 | hypothetical protein | - |
| NYR65_RS04795 (NYR65_04795) | - | 1033235..1033561 (+) | 327 | WP_005607856.1 | hypothetical protein | - |
| NYR65_RS04800 (NYR65_04800) | - | 1033579..1035069 (+) | 1491 | WP_039197074.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| NYR65_RS04805 (NYR65_04805) | - | 1035105..1035491 (-) | 387 | WP_005607864.1 | hypothetical protein | - |
| NYR65_RS04810 (NYR65_04810) | - | 1035624..1036037 (-) | 414 | WP_005607867.1 | hypothetical protein | - |
| NYR65_RS04815 (NYR65_04815) | - | 1036059..1038059 (-) | 2001 | WP_005607871.1 | integrating conjugative element protein | - |
| NYR65_RS04820 (NYR65_04820) | - | 1038079..1039017 (-) | 939 | WP_005607875.1 | TIGR03756 family integrating conjugative element protein | - |
| NYR65_RS04825 (NYR65_04825) | - | 1039014..1039400 (-) | 387 | WP_051889504.1 | TIGR03757 family integrating conjugative element protein | - |
| NYR65_RS04830 (NYR65_04830) | - | 1039860..1040210 (+) | 351 | WP_005607882.1 | hypothetical protein | - |
| NYR65_RS04835 (NYR65_04835) | - | 1040356..1040535 (+) | 180 | WP_100068060.1 | hypothetical protein | - |
| NYR65_RS04840 (NYR65_04840) | - | 1040609..1041490 (+) | 882 | WP_052190389.1 | hypothetical protein | - |
| NYR65_RS04845 (NYR65_04845) | - | 1041572..1042543 (+) | 972 | WP_039197075.1 | zincin-like metallopeptidase domain-containing protein | - |
| NYR65_RS04850 (NYR65_04850) | - | 1042729..1043166 (-) | 438 | WP_005620741.1 | hypothetical protein | - |
| NYR65_RS04855 (NYR65_04855) | - | 1043186..1043467 (-) | 282 | WP_005620740.1 | hypothetical protein | - |
| NYR65_RS04860 (NYR65_04860) | - | 1043731..1044318 (+) | 588 | WP_005620738.1 | recombinase family protein | - |
| NYR65_RS04865 (NYR65_04865) | mobH | 1044417..1046330 (+) | 1914 | WP_005607899.1 | MobH family relaxase | - |
| NYR65_RS04870 (NYR65_04870) | - | 1046495..1047253 (+) | 759 | WP_231554693.1 | site-specific integrase | - |
| NYR65_RS04875 (NYR65_04875) | - | 1047410..1047964 (-) | 555 | WP_039197076.1 | PBECR4 domain-containing protein | - |
| NYR65_RS04880 (NYR65_04880) | - | 1048683..1056404 (-) | 7722 | WP_039197077.1 | YadA-like family protein | - |
| NYR65_RS04885 (NYR65_04885) | - | 1056946..1057728 (-) | 783 | WP_039197078.1 | MmcQ/YjbR family DNA-binding protein | - |
| NYR65_RS04890 (NYR65_04890) | - | 1057821..1058857 (-) | 1037 | Protein_952 | oligopeptide/dipeptide ABC transporter ATP-binding protein | - |
| NYR65_RS04895 (NYR65_04895) | - | 1058874..1059761 (-) | 888 | WP_039197080.1 | ABC transporter permease subunit | - |
| NYR65_RS04900 (NYR65_04900) | - | 1059751..1060713 (-) | 963 | WP_039197082.1 | ABC transporter permease subunit | - |
| NYR65_RS04905 (NYR65_04905) | - | 1060716..1062407 (-) | 1692 | WP_039197083.1 | ABC transporter substrate-binding protein | - |
| NYR65_RS04910 (NYR65_04910) | - | 1062423..1063571 (-) | 1149 | WP_039197084.1 | sigma 54-interacting transcriptional regulator | - |
| NYR65_RS04915 (NYR65_04915) | lpcA | 1063794..1064378 (+) | 585 | WP_039197085.1 | D-sedoheptulose 7-phosphate isomerase | - |
| NYR65_RS04920 (NYR65_04920) | - | 1064481..1065455 (-) | 975 | WP_039197087.1 | substrate-binding domain-containing protein | - |
| NYR65_RS04925 (NYR65_04925) | - | 1065671..1067179 (-) | 1509 | WP_039197088.1 | Na+/H+ antiporter NhaC family protein | - |
| NYR65_RS04930 (NYR65_04930) | - | 1067736..1068143 (+) | 408 | WP_039197089.1 | H-NS family nucleoid-associated regulatory protein | - |
| NYR65_RS04935 (NYR65_04935) | - | 1068636..1070228 (+) | 1593 | WP_039197090.1 | L-lactate permease | - |
| NYR65_RS04940 (NYR65_04940) | - | 1070408..1071133 (+) | 726 | WP_039197091.1 | (Fe-S)-binding protein | - |
| NYR65_RS04945 (NYR65_04945) | - | 1071149..1072558 (+) | 1410 | WP_039197093.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| NYR65_RS04950 (NYR65_04950) | - | 1072697..1073398 (+) | 702 | WP_039197094.1 | lactate utilization protein C | - |
| NYR65_RS04955 (NYR65_04955) | - | 1073474..1074181 (-) | 708 | WP_039197095.1 | ElyC/SanA/YdcF family protein | - |
| NYR65_RS04960 (NYR65_04960) | - | 1074451..1075521 (+) | 1071 | WP_039197096.1 | homoserine O-acetyltransferase | - |
Sequence
Protein
Download Length: 144 a.a. Molecular weight: 16283.02 Da Isoelectric Point: 5.6770
>NTDB_id=725279 NYR65_RS04660 WP_005607789.1 1011375..1011809(+) (ssb) [Actinobacillus equuli subsp. equuli strain CCUG2041]
MAGINKVIIVGHLGNEPEMRTMPNGEAVANISVATSESWTDKTTGERREVTEWHRIVFYRRQAEVVGQYLHKGSQVYVEG
RLRTRKWQDQNGQDRYTTEIQGDILQMLGGRNNGTSPAPTQNQPTNAVNQTEPPINNFDDDIPF
MAGINKVIIVGHLGNEPEMRTMPNGEAVANISVATSESWTDKTTGERREVTEWHRIVFYRRQAEVVGQYLHKGSQVYVEG
RLRTRKWQDQNGQDRYTTEIQGDILQMLGGRNNGTSPAPTQNQPTNAVNQTEPPINNFDDDIPF
Nucleotide
Download Length: 435 bp
>NTDB_id=725279 NYR65_RS04660 WP_005607789.1 1011375..1011809(+) (ssb) [Actinobacillus equuli subsp. equuli strain CCUG2041]
ATGGCTGGTATCAATAAAGTCATTATTGTTGGGCATCTCGGCAATGAACCTGAAATGCGAACTATGCCGAATGGTGAAGC
AGTTGCAAATATCAGTGTTGCAACAAGTGAAAGCTGGACGGATAAAACGACCGGAGAACGTCGTGAAGTAACAGAATGGC
ATCGAATTGTATTCTATCGCCGTCAAGCAGAAGTAGTTGGTCAATATCTCCACAAGGGTTCACAAGTATATGTAGAAGGC
CGTCTACGCACACGTAAATGGCAAGATCAGAATGGTCAAGATCGTTATACGACCGAAATTCAAGGTGATATATTACAAAT
GCTAGGTGGACGTAATAATGGAACTTCTCCTGCTCCAACACAAAATCAACCGACTAATGCAGTTAATCAAACGGAGCCTC
CGATAAATAACTTTGATGACGATATTCCGTTCTGA
ATGGCTGGTATCAATAAAGTCATTATTGTTGGGCATCTCGGCAATGAACCTGAAATGCGAACTATGCCGAATGGTGAAGC
AGTTGCAAATATCAGTGTTGCAACAAGTGAAAGCTGGACGGATAAAACGACCGGAGAACGTCGTGAAGTAACAGAATGGC
ATCGAATTGTATTCTATCGCCGTCAAGCAGAAGTAGTTGGTCAATATCTCCACAAGGGTTCACAAGTATATGTAGAAGGC
CGTCTACGCACACGTAAATGGCAAGATCAGAATGGTCAAGATCGTTATACGACCGAAATTCAAGGTGATATATTACAAAT
GCTAGGTGGACGTAATAATGGAACTTCTCCTGCTCCAACACAAAATCAACCGACTAATGCAGTTAATCAAACGGAGCCTC
CGATAAATAACTTTGATGACGATATTCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
62.778 |
100 |
0.785 |
| ssb | Vibrio cholerae strain A1552 |
52.601 |
100 |
0.632 |
| ssb | Neisseria meningitidis MC58 |
43.353 |
100 |
0.521 |
| ssb | Neisseria gonorrhoeae MS11 |
43.353 |
100 |
0.521 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
31.977 |
100 |
0.382 |