Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   NYR91_RS12310 Genome accession   NZ_CP103784
Coordinates   2404782..2405165 (-) Length   127 a.a.
NCBI ID   WP_041519396.1    Uniprot ID   -
Organism   Bacillus subtilis strain RO-NN-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2399782..2410165
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYR91_RS12270 (NYR91_12270) sinI 2400713..2400886 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  NYR91_RS12275 (NYR91_12275) sinR 2400920..2401255 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NYR91_RS12280 (NYR91_12280) tasA 2401347..2402132 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  NYR91_RS12285 (NYR91_12285) sipW 2402197..2402769 (-) 573 WP_014477325.1 signal peptidase I SipW -
  NYR91_RS12290 (NYR91_12290) tapA 2402753..2403514 (-) 762 WP_014477326.1 amyloid fiber anchoring/assembly protein TapA -
  NYR91_RS12295 (NYR91_12295) yqzG 2403788..2404114 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NYR91_RS12300 (NYR91_12300) spoIITA 2404156..2404335 (-) 180 WP_014477327.1 YqzE family protein -
  NYR91_RS12305 (NYR91_12305) comGG 2404407..2404781 (-) 375 WP_014477328.1 ComG operon protein ComGG Machinery gene
  NYR91_RS12310 (NYR91_12310) comGF 2404782..2405165 (-) 384 WP_041519396.1 ComG operon protein ComGF Machinery gene
  NYR91_RS12315 (NYR91_12315) comGE 2405191..2405538 (-) 348 WP_014477330.1 ComG operon protein 5 Machinery gene
  NYR91_RS12320 (NYR91_12320) comGD 2405522..2405953 (-) 432 WP_014477331.1 comG operon protein ComGD Machinery gene
  NYR91_RS12325 (NYR91_12325) comGC 2405943..2406239 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  NYR91_RS12330 (NYR91_12330) comGB 2406253..2407290 (-) 1038 WP_014477333.1 comG operon protein ComGB Machinery gene
  NYR91_RS12335 (NYR91_12335) comGA 2407277..2408347 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  NYR91_RS12340 (NYR91_12340) corA 2408758..2409711 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14328.43 Da        Isoelectric Point: 6.2129

>NTDB_id=725020 NYR91_RS12310 WP_041519396.1 2404782..2405165(-) (comGF) [Bacillus subtilis strain RO-NN-1]
MLISGSLATIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHIAAMKADIENGVVLLKIESENQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=725020 NYR91_RS12310 WP_041519396.1 2404782..2405165(-) (comGF) [Bacillus subtilis strain RO-NN-1]
TTGCTCATATCAGGATCGTTAGCTACGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGAAATTTATCATTCAATGATCAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTGCTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGAACCAAAAAGTGTATCAAACTGCTTTTCCGGTTTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.063

100

0.961