Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NYR91_RS12270 Genome accession   NZ_CP103784
Coordinates   2400713..2400886 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain RO-NN-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2395713..2405886
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYR91_RS12255 (NYR91_12255) gcvT 2396511..2397599 (-) 1089 WP_014477320.1 glycine cleavage system aminomethyltransferase GcvT -
  NYR91_RS12260 (NYR91_12260) hepAA 2398041..2399714 (+) 1674 WP_014477321.1 DEAD/DEAH box helicase -
  NYR91_RS12265 (NYR91_12265) yqhG 2399735..2400529 (+) 795 WP_014477322.1 YqhG family protein -
  NYR91_RS12270 (NYR91_12270) sinI 2400713..2400886 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  NYR91_RS12275 (NYR91_12275) sinR 2400920..2401255 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NYR91_RS12280 (NYR91_12280) tasA 2401347..2402132 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  NYR91_RS12285 (NYR91_12285) sipW 2402197..2402769 (-) 573 WP_014477325.1 signal peptidase I SipW -
  NYR91_RS12290 (NYR91_12290) tapA 2402753..2403514 (-) 762 WP_014477326.1 amyloid fiber anchoring/assembly protein TapA -
  NYR91_RS12295 (NYR91_12295) yqzG 2403788..2404114 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NYR91_RS12300 (NYR91_12300) spoIITA 2404156..2404335 (-) 180 WP_014477327.1 YqzE family protein -
  NYR91_RS12305 (NYR91_12305) comGG 2404407..2404781 (-) 375 WP_014477328.1 ComG operon protein ComGG Machinery gene
  NYR91_RS12310 (NYR91_12310) comGF 2404782..2405165 (-) 384 WP_041519396.1 ComG operon protein ComGF Machinery gene
  NYR91_RS12315 (NYR91_12315) comGE 2405191..2405538 (-) 348 WP_014477330.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=725017 NYR91_RS12270 WP_014477323.1 2400713..2400886(+) (sinI) [Bacillus subtilis strain RO-NN-1]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=725017 NYR91_RS12270 WP_014477323.1 2400713..2400886(+) (sinI) [Bacillus subtilis strain RO-NN-1]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982