Detailed information NTG0721072

Bioinformatically predicted

Overview

• Name: comGF
• Type: Machinery gene
• Locus tag: PUW77_RS01165
• Genome accession: NZ_CP118079
• Coordinates: 200645..201106 (+)
• Length: 153 a.a.
• NCBI ID: WP_001874812.1
• Uniprot ID: -
• Organism: Streptococcus agalactiae strain VSI15
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 195645..206106

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PUW77_RS01135 (PUW77_01135)	-	197260..197625 (+)	366	WP_000285373.1	DUF1033 family protein	-
PUW77_RS01140 (PUW77_01140)	comGA	197798..198769 (+)	972	WP_000250805.1	competence type IV pilus ATPase ComGA	Machinery gene
PUW77_RS01145 (PUW77_01145)	comGB	198663..199706 (+)	1044	WP_223295889.1	competence type IV pilus assembly protein ComGB	Machinery gene
PUW77_RS01150 (PUW77_01150)	comGC/cglC	199703..200032 (+)	330	WP_000793380.1	competence type IV pilus major pilin ComGC	Machinery gene
PUW77_RS01155 (PUW77_01155)	comGD	200007..200420 (+)	414	WP_000244261.1	competence type IV pilus minor pilin ComGD	Machinery gene
PUW77_RS01160 (PUW77_01160)	comGE	200392..200691 (+)	300	WP_000234804.1	competence type IV pilus minor pilin ComGE	Machinery gene
PUW77_RS01165 (PUW77_01165)	comGF	200645..201106 (+)	462	WP_001874812.1	competence type IV pilus minor pilin ComGF	Machinery gene
PUW77_RS01170 (PUW77_01170)	comGG	201084..201455 (+)	372	WP_000601104.1	competence type IV pilus minor pilin ComGG	Machinery gene
PUW77_RS01175 (PUW77_01175)	comGH	201570..202544 (+)	975	WP_001008574.1	N-6 DNA methylase	Machinery gene
PUW77_RS01180 (PUW77_01180)	-	202576..203769 (+)	1194	WP_000047534.1	acetate kinase	-
PUW77_RS01185 (PUW77_01185)	-	203921..204127 (+)	207	WP_000798241.1	helix-turn-helix transcriptional regulator	-
PUW77_RS01190 (PUW77_01190)	-	204186..204323 (+)	138	WP_001865900.1	hypothetical protein	-
PUW77_RS01195 (PUW77_01195)	-	204364..204819 (+)	456	WP_000905673.1	hypothetical protein	-
PUW77_RS01200 (PUW77_01200)	-	204888..205553 (+)	666	WP_000008113.1	type II CAAX endopeptidase family protein	-

Sequence

Protein

• Length: 153 a.a.
• Molecular weight: 17875.89 Da
• Isoelectric Point: 9.8392

>NTDB_id=721072 PUW77_RS01165 WP_001874812.1 200645..201106(+) (comGF) [Streptococcus agalactiae strain VSI15]
MKIIRKFCTYQKLRVKAFTLLECLVALVTITGALLVYQGLTKLLAQQIVVMSSSSQSEWVLLTQQLNAEFEGAHLEYLRQ
NKLYLRKQDKIVTFGKSNKDDFRKTGYDGRGYQPMVYGLDNCQMSQTKSMVKLVFYFKDGLKRTFYYDFKEET

Nucleotide

• Length: 462 bp

>NTDB_id=721072 PUW77_RS01165 WP_001874812.1 200645..201106(+) (comGF) [Streptococcus agalactiae strain VSI15]
TTGAAGATAATAAGGAAATTTTGCACGTATCAAAAGTTAAGGGTTAAAGCATTTACGCTTTTAGAATGTTTGGTAGCATT
GGTTACAATCACAGGAGCTTTACTAGTTTATCAAGGACTGACAAAATTGTTGGCTCAACAGATAGTAGTGATGTCTTCTT
CCAGTCAGTCTGAATGGGTGTTATTAACTCAGCAACTAAATGCAGAATTTGAAGGCGCTCATCTGGAATATTTAAGACAG
AACAAACTTTATTTACGTAAGCAAGATAAGATTGTAACCTTTGGCAAATCTAATAAAGATGATTTCCGTAAGACAGGTTA
TGATGGTCGAGGTTATCAACCAATGGTTTATGGGTTAGACAATTGTCAAATGAGTCAGACCAAAAGTATGGTAAAACTTG
TTTTTTATTTTAAGGACGGGTTAAAAAGGACATTTTACTATGATTTTAAAGAAGAAACTTAA

Domains

Predicted by InterProScan.

• Putative Competence protein ComGF (ComGF) (49-142)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGF	Streptococcus mutans UA159	47.887	92.81	0.444
comGF	Streptococcus mutans UA140	47.887	92.81	0.444
comGF/cglF	Streptococcus pneumoniae Rx1	43.165	90.85	0.392
comGF/cglF	Streptococcus pneumoniae D39	43.165	90.85	0.392
comGF/cglF	Streptococcus pneumoniae R6	43.165	90.85	0.392
comGF/cglF	Streptococcus pneumoniae TIGR4	43.165	90.85	0.392
comGF/cglF	Streptococcus mitis SK321	44.03	87.582	0.386
comGF/cglF	Streptococcus mitis NCTC 12261	43.284	87.582	0.379
comGF	Lactococcus lactis subsp. cremoris KW2	40.714	91.503	0.373