Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   ACKTUA_RS00655 Genome accession   NZ_AP018946
Coordinates   125877..126323 (-) Length   148 a.a.
NCBI ID   WP_407901452.1    Uniprot ID   -
Organism   Providencia rustigianii strain JH-1     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 121233..164471 125877..126323 within 0


Gene organization within MGE regions


Location: 121233..164471
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACKTUA_RS00600 (PRJH_0116) - 121233..122516 (-) 1284 WP_407901441.1 Arm DNA-binding domain-containing protein -
  ACKTUA_RS00605 xisR 122524..122760 (-) 237 WP_006659470.1 excisionase family protein -
  ACKTUA_RS00610 (PRJH_0117) - 122753..123058 (-) 306 WP_407901442.1 hypothetical protein -
  ACKTUA_RS00615 (PRJH_0118) - 123172..123717 (-) 546 WP_407901444.1 phage N-6-adenine-methyltransferase -
  ACKTUA_RS00620 (PRJH_0119) - 123707..124051 (-) 345 WP_407901445.1 phage protein NinX family protein -
  ACKTUA_RS00625 (PRJH_0120) - 124204..124377 (-) 174 WP_407901447.1 hypothetical protein -
  ACKTUA_RS00630 (PRJH_0121) - 124380..124697 (-) 318 WP_407901448.1 hypothetical protein -
  ACKTUA_RS00635 (PRJH_0122) - 124697..124993 (-) 297 WP_407901449.1 hypothetical protein -
  ACKTUA_RS00640 (PRJH_0123) - 125025..125216 (-) 192 WP_407901450.1 hypothetical protein -
  ACKTUA_RS00645 (PRJH_0124) - 125260..125538 (-) 279 WP_407901451.1 hypothetical protein -
  ACKTUA_RS00650 (PRJH_0125) - 125558..125845 (-) 288 WP_096864293.1 hypothetical protein -
  ACKTUA_RS00655 (PRJH_0126) ssb 125877..126323 (-) 447 WP_407901452.1 single-stranded DNA-binding protein Machinery gene
  ACKTUA_RS00660 (PRJH_0127) - 126317..127012 (-) 696 WP_407901453.1 lambda exonuclease family protein -
  ACKTUA_RS00665 (PRJH_0128) - 127009..127893 (-) 885 WP_407901454.1 recombinase RecT -
  ACKTUA_RS00670 (PRJH_0129) - 127890..128096 (-) 207 WP_272519564.1 hypothetical protein -
  ACKTUA_RS00675 (PRJH_0131) - 128563..129504 (-) 942 WP_407901455.1 cell envelope biogenesis protein TolA -
  ACKTUA_RS00680 (PRJH_0132) - 129569..129832 (-) 264 WP_407901456.1 hypothetical protein -
  ACKTUA_RS00685 (PRJH_0133) - 129834..130034 (-) 201 WP_407901457.1 hypothetical protein -
  ACKTUA_RS00690 (PRJH_0134) - 130068..130679 (-) 612 WP_407901458.1 Nmad5 family putative nucleotide modification protein -
  ACKTUA_RS00695 (PRJH_0135) - 130740..130901 (-) 162 WP_407901459.1 hypothetical protein -
  ACKTUA_RS00700 (PRJH_0136) - 130972..131280 (-) 309 WP_154601192.1 hypothetical protein -
  ACKTUA_RS00705 (PRJH_0137) - 131661..132536 (-) 876 WP_249743606.1 hypothetical protein -
  ACKTUA_RS00710 (PRJH_0138) - 132594..133274 (-) 681 WP_180312646.1 LexA family transcriptional regulator -
  ACKTUA_RS00715 (PRJH_0139) - 133354..133581 (+) 228 WP_006659494.1 AlpA family transcriptional regulator -
  ACKTUA_RS00720 (PRJH_0140) - 133685..134002 (+) 318 WP_407901460.1 CII family transcriptional regulator -
  ACKTUA_RS00725 (PRJH_0141) - 134024..134710 (+) 687 WP_407901461.1 phage antirepressor KilAC domain-containing protein -
  ACKTUA_RS00730 (PRJH_0142) - 134707..135507 (+) 801 WP_407901462.1 replication protein -
  ACKTUA_RS00735 (PRJH_0143) - 135507..136235 (+) 729 WP_407901463.1 ATP-binding protein -
  ACKTUA_RS00740 - 136261..136512 (+) 252 WP_265497276.1 hypothetical protein -
  ACKTUA_RS00745 (PRJH_0145) - 136528..136749 (+) 222 WP_407901464.1 hypothetical protein -
  ACKTUA_RS00750 - 136749..136997 (+) 249 WP_126459692.1 DUF551 domain-containing protein -
  ACKTUA_RS00755 (PRJH_0146) - 136997..137191 (+) 195 WP_210850018.1 Lar family restriction alleviation protein -
  ACKTUA_RS00760 (PRJH_0147) - 137184..137405 (+) 222 WP_407901465.1 hypothetical protein -
  ACKTUA_RS00765 (PRJH_0148) - 137407..137853 (+) 447 WP_126459700.1 DUF1367 family protein -
  ACKTUA_RS00770 - 137869..138039 (+) 171 WP_407901466.1 hypothetical protein -
  ACKTUA_RS00775 (PRJH_0149) - 138039..138182 (+) 144 WP_407901467.1 hypothetical protein -
  ACKTUA_RS00780 (PRJH_0150) - 138179..138331 (+) 153 WP_407901468.1 hypothetical protein -
  ACKTUA_RS00785 - 138324..138614 (+) 291 WP_407901469.1 DUF1364 domain-containing protein -
  ACKTUA_RS00790 - 138611..138976 (+) 366 WP_407901470.1 RusA family crossover junction endodeoxyribonuclease -
  ACKTUA_RS00795 (PRJH_0152) - 139163..139921 (+) 759 WP_265498574.1 antitermination protein -
  ACKTUA_RS00800 (PRJH_0154) - 140332..140745 (+) 414 WP_036983124.1 putative holin -
  ACKTUA_RS00805 (PRJH_0155) - 140742..141059 (+) 318 WP_407901472.1 hypothetical protein -
  ACKTUA_RS00810 (PRJH_0156) - 141007..141399 (+) 393 WP_407901473.1 M15 family metallopeptidase -
  ACKTUA_RS00815 (PRJH_0157) - 141396..141845 (+) 450 WP_407901474.1 lysis protein -
  ACKTUA_RS00820 (PRJH_0158) - 142050..142214 (+) 165 WP_164717582.1 hypothetical protein -
  ACKTUA_RS00825 (PRJH_0159) - 142303..142827 (+) 525 WP_407901475.1 terminase small subunit -
  ACKTUA_RS00830 (PRJH_0160) - 142820..144169 (+) 1350 WP_407901476.1 PBSX family phage terminase large subunit -
  ACKTUA_RS00835 (PRJH_0161) - 144169..145701 (+) 1533 WP_407901477.1 DUF1073 domain-containing protein -
  ACKTUA_RS00840 (PRJH_0162) - 145709..146464 (+) 756 WP_407901478.1 phage minor head protein -
  ACKTUA_RS00845 (PRJH_0163) - 146477..147691 (+) 1215 WP_407901479.1 DUF2213 domain-containing protein -
  ACKTUA_RS00850 (PRJH_0164) - 147704..148189 (+) 486 WP_407901480.1 hypothetical protein -
  ACKTUA_RS00855 (PRJH_0165) - 148199..149197 (+) 999 WP_407901481.1 DUF2184 domain-containing protein -
  ACKTUA_RS00860 (PRJH_0166) - 149257..149574 (+) 318 WP_164529004.1 hypothetical protein -
  ACKTUA_RS00865 (PRJH_0167) - 149601..150059 (+) 459 WP_407901482.1 DUF4054 domain-containing protein -
  ACKTUA_RS00870 (PRJH_0168) - 150052..150504 (+) 453 WP_407901483.1 hypothetical protein -
  ACKTUA_RS00875 (PRJH_0169) - 150491..150874 (+) 384 WP_407901484.1 hypothetical protein -
  ACKTUA_RS00880 (PRJH_0170) - 150859..151347 (+) 489 WP_407901485.1 LIC_12616 family protein -
  ACKTUA_RS00885 (PRJH_0171) - 151357..152817 (+) 1461 WP_407901486.1 DUF3383 domain-containing protein -
  ACKTUA_RS00890 (PRJH_0172) - 152831..153277 (+) 447 WP_051473540.1 phage tail fiber protein -
  ACKTUA_RS00895 (PRJH_0173) - 153277..153687 (+) 411 WP_154633697.1 hypothetical protein -
  ACKTUA_RS00900 (PRJH_0175) - 154144..156291 (+) 2148 WP_407901487.1 hypothetical protein -
  ACKTUA_RS00905 (PRJH_0176) - 156355..156819 (+) 465 WP_407901488.1 hypothetical protein -
  ACKTUA_RS00910 (PRJH_0177) - 156978..157451 (+) 474 WP_407901489.1 hypothetical protein -
  ACKTUA_RS00915 (PRJH_0178) - 157570..158322 (+) 753 WP_195848939.1 phage baseplate protein -
  ACKTUA_RS00920 (PRJH_0179) - 158581..159468 (+) 888 WP_407901490.1 baseplate hub protein -
  ACKTUA_RS00925 (PRJH_0180) - 159455..160141 (+) 687 WP_407901491.1 phage baseplate protein -
  ACKTUA_RS00930 (PRJH_0181) - 160145..160498 (+) 354 WP_407901492.1 hypothetical protein -
  ACKTUA_RS00935 (PRJH_0182) - 160495..161685 (+) 1191 WP_407901493.1 baseplate J/gp47 family protein -
  ACKTUA_RS00940 (PRJH_0183) - 161685..162317 (+) 633 WP_407901494.1 DUF2612 domain-containing protein -
  ACKTUA_RS00945 (PRJH_0184) - 162325..163857 (+) 1533 WP_407901495.1 hypothetical protein -
  ACKTUA_RS00950 (PRJH_0185) - 163857..164471 (+) 615 WP_407901496.1 tail fiber assembly protein -

Sequence


Protein


Download         Length: 148 a.a.        Molecular weight: 16736.82 Da        Isoelectric Point: 6.9851

>NTDB_id=71999 ACKTUA_RS00655 WP_407901452.1 125877..126323(-) (ssb) [Providencia rustigianii strain JH-1]
MLNEVNIIGHLGNDPEIRYQPNGDAIATMSIGCSERWKDKKTGEQKEKTEWIRVVVFGKLAENVGEYLKKGSLVFVKGKF
RTRKWQDQSGQDRYSTEVTVGMDGIVKFLDKKPLSQSTQQQGGWGQPQQPAQQSNEPPMDFSDSDIPF

Nucleotide


Download         Length: 447 bp        

>NTDB_id=71999 ACKTUA_RS00655 WP_407901452.1 125877..126323(-) (ssb) [Providencia rustigianii strain JH-1]
ATGCTAAACGAAGTAAATATTATTGGTCATCTTGGCAATGATCCTGAAATCCGATACCAGCCTAACGGTGATGCTATCGC
AACTATGTCTATCGGATGCTCAGAGCGTTGGAAAGACAAAAAAACTGGCGAGCAAAAAGAAAAAACTGAATGGATACGTG
TTGTTGTGTTTGGAAAATTAGCTGAAAACGTTGGAGAGTATCTTAAAAAAGGTTCGCTAGTTTTTGTAAAAGGAAAATTC
CGAACTAGAAAATGGCAAGATCAGTCAGGACAAGATAGATATTCGACTGAGGTCACTGTTGGAATGGATGGCATCGTGAA
GTTTCTAGACAAGAAACCACTGTCACAATCCACACAGCAACAAGGTGGATGGGGACAACCACAGCAACCAGCCCAGCAAA
GCAATGAGCCACCAATGGACTTCAGCGACTCAGATATACCCTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

53.757

100

0.628

  ssb Glaesserella parasuis strain SC1401

44.751

100

0.547

  ssb Neisseria meningitidis MC58

40.278

97.297

0.392

  ssb Neisseria gonorrhoeae MS11

40.278

97.297

0.392

  ssb Latilactobacillus sakei subsp. sakei 23K

30.682

100

0.365


Multiple sequence alignment