Detailed information
Bioinformatically predicted
Overview
| Name | comW | Type | Regulator |
| Locus tag | EL263_RS00110 | Genome accession | NZ_AP018938 |
| Coordinates | 22637..22873 (+) | Length | 78 a.a. |
| NCBI ID | WP_000939545.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain ATCC 49619 | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 23062..68962 | 22637..22873 | flank | 189 |
| IS/Tn | 22114..22320 | 22637..22873 | flank | 317 |
Gene organization within MGE regions
Location: 22114..68962
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL263_RS00110 (SPAT_0020) | comW | 22637..22873 (+) | 237 | WP_000939545.1 | sigma(X)-activator ComW | Regulator |
| EL263_RS00115 (SPAT_0021) | - | 23104..24390 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| EL263_RS00120 (SPAT_0022) | - | 24632..25780 (-) | 1149 | WP_000876732.1 | tyrosine-type recombinase/integrase | - |
| EL263_RS00130 (SPAT_0023) | - | 25966..26889 (-) | 924 | WP_000122591.1 | exonuclease domain-containing protein | - |
| EL263_RS00135 (SPAT_0024) | - | 26902..27285 (-) | 384 | WP_001865140.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EL263_RS00140 (SPAT_0025) | - | 27298..27663 (-) | 366 | WP_000492031.1 | helix-turn-helix domain-containing protein | - |
| EL263_RS00145 (SPAT_0026) | - | 27969..28451 (-) | 483 | WP_000842471.1 | hypothetical protein | - |
| EL263_RS00150 (SPAT_0027) | - | 28506..28709 (+) | 204 | WP_000032096.1 | hypothetical protein | - |
| EL263_RS00155 (SPAT_0028) | - | 28726..28923 (+) | 198 | WP_001057654.1 | hypothetical protein | - |
| EL263_RS00160 (SPAT_0030) | - | 29039..29698 (-) | 660 | WP_001865135.1 | hypothetical protein | - |
| EL263_RS00165 (SPAT_0031) | - | 29752..30468 (+) | 717 | WP_001865134.1 | ORF6C domain-containing protein | - |
| EL263_RS00170 (SPAT_0032) | - | 30481..30738 (+) | 258 | WP_000370959.1 | hypothetical protein | - |
| EL263_RS00175 (SPAT_0033) | - | 30824..31144 (+) | 321 | WP_000462826.1 | hypothetical protein | - |
| EL263_RS00180 (SPAT_0034) | - | 31160..31456 (+) | 297 | WP_001865133.1 | hypothetical protein | - |
| EL263_RS00185 (SPAT_0035) | - | 31449..32255 (+) | 807 | WP_054387342.1 | phage replisome organizer N-terminal domain-containing protein | - |
| EL263_RS00190 (SPAT_0037) | - | 32395..33165 (+) | 771 | WP_000228214.1 | ATP-binding protein | - |
| EL263_RS12015 (SPAT_0038) | - | 33180..33374 (+) | 195 | WP_000470305.1 | hypothetical protein | - |
| EL263_RS00200 (SPAT_0039) | - | 33374..33601 (+) | 228 | WP_050267377.1 | hypothetical protein | - |
| EL263_RS00205 (SPAT_0041) | - | 33728..33895 (+) | 168 | WP_000233203.1 | hypothetical protein | - |
| EL263_RS00215 (SPAT_0042) | - | 34223..34576 (+) | 354 | WP_001177094.1 | helix-turn-helix domain-containing protein | - |
| EL263_RS00220 (SPAT_0043) | - | 34558..35022 (+) | 465 | WP_000516820.1 | hypothetical protein | - |
| EL263_RS00225 (SPAT_0044) | - | 35131..35673 (+) | 543 | WP_001028147.1 | site-specific integrase | - |
| EL263_RS00230 | - | 36214..36420 (+) | 207 | WP_223842409.1 | HNH endonuclease | - |
| EL263_RS00235 (SPAT_0045) | - | 36557..37051 (+) | 495 | WP_054387340.1 | hypothetical protein | - |
| EL263_RS00240 (SPAT_0046) | - | 37044..38756 (+) | 1713 | WP_000230006.1 | terminase TerL endonuclease subunit | - |
| EL263_RS00245 (SPAT_0047) | - | 38765..39907 (+) | 1143 | WP_001812652.1 | phage portal protein | - |
| EL263_RS00250 (SPAT_0048) | - | 39954..40496 (+) | 543 | WP_000413203.1 | HK97 family phage prohead protease | - |
| EL263_RS00255 (SPAT_0049) | - | 40511..41764 (+) | 1254 | WP_000855224.1 | phage major capsid protein | - |
| EL263_RS00260 (SPAT_0050) | - | 41790..42125 (+) | 336 | WP_000154006.1 | hypothetical protein | - |
| EL263_RS00265 (SPAT_0051) | - | 42122..42427 (+) | 306 | WP_000842790.1 | head-tail adaptor protein | - |
| EL263_RS00270 (SPAT_0052) | - | 42427..42774 (+) | 348 | WP_001074487.1 | hypothetical protein | - |
| EL263_RS00275 (SPAT_0053) | - | 42761..43105 (+) | 345 | WP_000534621.1 | hypothetical protein | - |
| EL263_RS00280 (SPAT_0054) | - | 43119..43787 (+) | 669 | WP_000221469.1 | hypothetical protein | - |
| EL263_RS00285 (SPAT_0055) | - | 43789..44265 (+) | 477 | WP_000591561.1 | hypothetical protein | - |
| EL263_RS00295 (SPAT_0056) | - | 44452..47190 (+) | 2739 | WP_000852167.1 | phage tail tape measure protein | - |
| EL263_RS00300 (SPAT_0057) | - | 47187..47909 (+) | 723 | WP_050199190.1 | phage tail protein | - |
| EL263_RS00305 (SPAT_0058) | - | 47910..55871 (+) | 7962 | WP_114880801.1 | phage tail spike protein | - |
| EL263_RS12020 (SPAT_0059) | - | 55868..55984 (+) | 117 | WP_001063633.1 | hypothetical protein | - |
| EL263_RS00315 (SPAT_0060) | - | 55965..56168 (+) | 204 | WP_001091109.1 | hypothetical protein | - |
| EL263_RS00320 (SPAT_0061) | - | 56171..56521 (+) | 351 | WP_000852248.1 | hypothetical protein | - |
| EL263_RS00325 (SPAT_0062) | - | 56531..56947 (+) | 417 | WP_001165341.1 | phage holin family protein | - |
| EL263_RS00330 (SPAT_0063) | - | 56951..57283 (+) | 333 | WP_001186207.1 | phage holin | - |
| EL263_RS00335 (SPAT_0064) | lytA | 57287..58243 (+) | 957 | WP_000350489.1 | N-acetylmuramoyl-L-alanine amidase LytA | - |
| EL263_RS00340 (SPAT_0065) | - | 58512..58691 (-) | 180 | WP_001233269.1 | hypothetical protein | - |
| EL263_RS11410 (SPAT_0066) | - | 58833..58982 (-) | 150 | WP_162489709.1 | hypothetical protein | - |
| EL263_RS00345 (SPAT_0067) | tadA | 59252..59719 (+) | 468 | WP_000291874.1 | tRNA adenosine(34) deaminase TadA | - |
| EL263_RS00355 (SPAT_0068) | - | 59906..60349 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| EL263_RS00360 (SPAT_0069) | - | 60351..60866 (+) | 516 | WP_000691236.1 | histidine phosphatase family protein | - |
| EL263_RS00365 (SPAT_0070) | radA | 60880..62241 (+) | 1362 | WP_074017595.1 | DNA repair protein RadA | Machinery gene |
| EL263_RS00370 (SPAT_0071) | - | 62314..62811 (+) | 498 | WP_001809263.1 | beta-class carbonic anhydrase | - |
| EL263_RS00380 (SPAT_0072) | - | 62836..63650 (+) | 815 | Protein_66 | PrsW family intramembrane metalloprotease | - |
| EL263_RS00385 (SPAT_0073) | - | 63795..64763 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| EL263_RS11600 | - | 64881..65826 (+) | 946 | Protein_68 | Rpn family recombination-promoting nuclease/putative transposase | - |
| EL263_RS00405 (SPAT_0076) | polA | 66329..68962 (+) | 2634 | WP_050279195.1 | DNA polymerase I | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9658.13 Da Isoelectric Point: 6.7051
>NTDB_id=71920 EL263_RS00110 WP_000939545.1 22637..22873(+) (comW) [Streptococcus pneumoniae strain ATCC 49619]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=71920 EL263_RS00110 WP_000939545.1 22637..22873(+) (comW) [Streptococcus pneumoniae strain ATCC 49619]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAAGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAAGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comW | Streptococcus mitis SK321 |
75.641 |
100 |
0.756 |
| comW | Streptococcus mitis NCTC 12261 |
75.325 |
98.718 |
0.744 |