Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   NUW85_RS00200 Genome accession   NZ_CP102603
Coordinates   30549..30863 (+) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain MBLB0692     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 25549..35863
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NUW85_RS00175 (NUW85_00175) - 26583..27533 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  NUW85_RS00180 (NUW85_00180) comGA 27731..28801 (+) 1071 WP_043867287.1 competence type IV pilus ATPase ComGA Machinery gene
  NUW85_RS00185 (NUW85_00185) comGB 28788..29825 (+) 1038 WP_043867286.1 competence type IV pilus assembly protein ComGB Machinery gene
  NUW85_RS00190 (NUW85_00190) comGC 29872..30138 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  NUW85_RS00195 (NUW85_00195) comGD 30128..30565 (+) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  NUW85_RS00200 (NUW85_00200) comGE 30549..30863 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  NUW85_RS00205 (NUW85_00205) comGF 30877..31272 (+) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF -
  NUW85_RS00210 (NUW85_00210) comGG 31273..31650 (+) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  NUW85_RS00215 (NUW85_00215) - 31707..31886 (+) 180 WP_003153093.1 YqzE family protein -
  NUW85_RS00220 (NUW85_00220) - 31926..32255 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  NUW85_RS00225 (NUW85_00225) tapA 32514..33185 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  NUW85_RS00230 (NUW85_00230) - 33157..33741 (+) 585 WP_012117977.1 signal peptidase I -
  NUW85_RS00235 (NUW85_00235) - 33805..34590 (+) 786 WP_003153102.1 TasA family protein -
  NUW85_RS00240 (NUW85_00240) sinR 34638..34973 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NUW85_RS00245 (NUW85_00245) sinI 35007..35180 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=718008 NUW85_RS00200 WP_015388003.1 30549..30863(+) (comGE) [Bacillus amyloliquefaciens strain MBLB0692]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=718008 NUW85_RS00200 WP_015388003.1 30549..30863(+) (comGE) [Bacillus amyloliquefaciens strain MBLB0692]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481