Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   NKZ81_RS07830 Genome accession   NZ_CP100328
Coordinates   1581964..1582425 (-) Length   153 a.a.
NCBI ID   WP_002937951.1    Uniprot ID   -
Organism   Streptococcus suis strain STC86     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1557391..1605604 1581964..1582425 within 0


Gene organization within MGE regions


Location: 1557391..1605604
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NKZ81_RS07655 (NKZ81_07655) - 1557391..1557756 (-) 366 Protein_1465 HAD-IA family hydrolase -
  NKZ81_RS07660 (NKZ81_07660) - 1558179..1558556 (-) 378 WP_024394270.1 PBECR2 nuclease fold domain-containing protein -
  NKZ81_RS07665 (NKZ81_07665) - 1558621..1559358 (-) 738 WP_014636660.1 PlySs2 family phage lysin -
  NKZ81_RS07670 (NKZ81_07670) - 1559342..1559692 (-) 351 WP_002937841.1 phage holin -
  NKZ81_RS07675 (NKZ81_07675) - 1559695..1559994 (-) 300 WP_014636661.1 hypothetical protein -
  NKZ81_RS07680 (NKZ81_07680) - 1559998..1560342 (-) 345 WP_002937844.1 hypothetical protein -
  NKZ81_RS07685 (NKZ81_07685) - 1560345..1560563 (-) 219 WP_002937846.1 hypothetical protein -
  NKZ81_RS07690 (NKZ81_07690) - 1560572..1565914 (-) 5343 WP_204101658.1 phage tail spike protein -
  NKZ81_RS07695 (NKZ81_07695) - 1565911..1566606 (-) 696 WP_002937853.1 adenylosuccinate synthetase -
  NKZ81_RS07700 (NKZ81_07700) - 1566606..1569188 (-) 2583 WP_044768633.1 phage tail protein -
  NKZ81_RS07705 (NKZ81_07705) - 1569178..1569561 (-) 384 WP_002937861.1 DUF5361 domain-containing protein -
  NKZ81_RS07710 (NKZ81_07710) - 1569558..1569836 (-) 279 WP_024379224.1 hypothetical protein -
  NKZ81_RS07715 (NKZ81_07715) - 1569847..1570434 (-) 588 WP_204101659.1 phage tail protein -
  NKZ81_RS07720 (NKZ81_07720) - 1570450..1570785 (-) 336 WP_002937874.1 hypothetical protein -
  NKZ81_RS07725 (NKZ81_07725) - 1570782..1571021 (-) 240 WP_002937877.1 hypothetical protein -
  NKZ81_RS07730 (NKZ81_07730) - 1571014..1571352 (-) 339 WP_002937879.1 hypothetical protein -
  NKZ81_RS07735 (NKZ81_07735) - 1571339..1571734 (-) 396 WP_002937880.1 phage Gp19/Gp15/Gp42 family protein -
  NKZ81_RS07740 (NKZ81_07740) - 1571738..1571962 (-) 225 WP_002937881.1 HeH/LEM domain-containing protein -
  NKZ81_RS07745 (NKZ81_07745) - 1571964..1572866 (-) 903 WP_002937882.1 phage major capsid protein -
  NKZ81_RS07750 (NKZ81_07750) - 1572881..1573351 (-) 471 WP_002937883.1 DUF4355 domain-containing protein -
  NKZ81_RS07755 (NKZ81_07755) - 1573434..1574849 (-) 1416 WP_002937884.1 terminase -
  NKZ81_RS11290 - 1574994..1575125 (-) 132 WP_002937886.1 hypothetical protein -
  NKZ81_RS07760 (NKZ81_07760) - 1575194..1575406 (-) 213 WP_002937901.1 hypothetical protein -
  NKZ81_RS07765 (NKZ81_07765) - 1575403..1576482 (-) 1080 WP_002937903.1 hypothetical protein -
  NKZ81_RS07770 (NKZ81_07770) - 1576475..1577740 (-) 1266 WP_002937907.1 phage portal protein -
  NKZ81_RS07775 (NKZ81_07775) - 1577737..1578099 (-) 363 WP_002937910.1 hypothetical protein -
  NKZ81_RS07780 (NKZ81_07780) - 1578178..1578525 (-) 348 WP_002937914.1 HNH endonuclease -
  NKZ81_RS07785 (NKZ81_07785) - 1578622..1579056 (-) 435 WP_002937915.1 DUF1492 domain-containing protein -
  NKZ81_RS07790 (NKZ81_07790) - 1579133..1579399 (-) 267 WP_226314725.1 hypothetical protein -
  NKZ81_RS07795 (NKZ81_07795) - 1579396..1579665 (-) 270 WP_002937922.1 hypothetical protein -
  NKZ81_RS07800 (NKZ81_07800) - 1579665..1579841 (-) 177 WP_002937925.1 hypothetical protein -
  NKZ81_RS07805 (NKZ81_07805) - 1579841..1580074 (-) 234 WP_002937935.1 hypothetical protein -
  NKZ81_RS07810 (NKZ81_07810) - 1580090..1580392 (-) 303 WP_002937939.1 DUF1372 family protein -
  NKZ81_RS07815 (NKZ81_07815) - 1580402..1580920 (-) 519 WP_002937943.1 hypothetical protein -
  NKZ81_RS07820 (NKZ81_07820) - 1580917..1581249 (-) 333 WP_002937944.1 hypothetical protein -
  NKZ81_RS07825 (NKZ81_07825) - 1581562..1581936 (-) 375 WP_002937949.1 hypothetical protein -
  NKZ81_RS07830 (NKZ81_07830) ssb 1581964..1582425 (-) 462 WP_002937951.1 single-stranded DNA-binding protein Machinery gene
  NKZ81_RS07835 (NKZ81_07835) - 1582528..1582707 (-) 180 WP_002937955.1 hypothetical protein -
  NKZ81_RS07840 (NKZ81_07840) - 1582697..1583023 (-) 327 WP_002937956.1 hypothetical protein -
  NKZ81_RS07845 (NKZ81_07845) - 1583033..1583302 (-) 270 WP_002937957.1 hypothetical protein -
  NKZ81_RS07850 (NKZ81_07850) - 1583305..1584333 (-) 1029 WP_172055947.1 DUF1351 domain-containing protein -
  NKZ81_RS07855 (NKZ81_07855) bet 1584343..1585113 (-) 771 WP_014636675.1 phage recombination protein Bet -
  NKZ81_RS07860 (NKZ81_07860) - 1585110..1585289 (-) 180 WP_004195116.1 hypothetical protein -
  NKZ81_RS11295 - 1585289..1585417 (-) 129 WP_014636676.1 hypothetical protein -
  NKZ81_RS07865 (NKZ81_07865) - 1585428..1585571 (-) 144 WP_014636677.1 hypothetical protein -
  NKZ81_RS07870 (NKZ81_07870) - 1585830..1586195 (-) 366 WP_004194647.1 hypothetical protein -
  NKZ81_RS07875 (NKZ81_07875) - 1586248..1586472 (-) 225 WP_004194648.1 hypothetical protein -
  NKZ81_RS07880 (NKZ81_07880) - 1586453..1586710 (-) 258 WP_014636678.1 hypothetical protein -
  NKZ81_RS07885 (NKZ81_07885) - 1586707..1586982 (-) 276 WP_014636679.1 hypothetical protein -
  NKZ81_RS07890 (NKZ81_07890) - 1587065..1587775 (-) 711 WP_014636680.1 phage antirepressor KilAC domain-containing protein -
  NKZ81_RS07895 (NKZ81_07895) - 1587829..1588518 (+) 690 WP_014636681.1 DUF4145 domain-containing protein -
  NKZ81_RS07900 (NKZ81_07900) - 1588614..1588835 (-) 222 WP_004195135.1 hypothetical protein -
  NKZ81_RS07905 (NKZ81_07905) - 1588888..1589115 (-) 228 WP_024414969.1 hypothetical protein -
  NKZ81_RS07910 (NKZ81_07910) - 1589122..1589313 (-) 192 WP_172051330.1 helix-turn-helix transcriptional regulator -
  NKZ81_RS11300 - 1589456..1589584 (+) 129 WP_255199034.1 hypothetical protein -
  NKZ81_RS07915 (NKZ81_07915) - 1589574..1589957 (-) 384 WP_226314723.1 ImmA/IrrE family metallo-endopeptidase -
  NKZ81_RS07920 (NKZ81_07920) - 1590028..1590222 (-) 195 WP_204108029.1 hypothetical protein -
  NKZ81_RS07925 (NKZ81_07925) - 1590321..1591085 (+) 765 WP_172051331.1 XRE family transcriptional regulator -
  NKZ81_RS07930 (NKZ81_07930) - 1591261..1591695 (+) 435 WP_004194675.1 type II toxin-antitoxin system PemK/MazF family toxin -
  NKZ81_RS07935 (NKZ81_07935) - 1591821..1592915 (+) 1095 WP_201326760.1 tyrosine-type recombinase/integrase -
  NKZ81_RS07945 (NKZ81_07945) - 1593222..1595246 (-) 2025 WP_029743814.1 bifunctional UDP-sugar hydrolase/5'-nucleotidase -
  NKZ81_RS07950 (NKZ81_07950) - 1595386..1596339 (-) 954 WP_024376800.1 IS30 family transposase -
  NKZ81_RS07955 (NKZ81_07955) sodA 1596753..1597358 (-) 606 WP_013730459.1 superoxide dismutase SodA -
  NKZ81_RS07960 (NKZ81_07960) holA 1597471..1598502 (-) 1032 WP_024417674.1 DNA polymerase III subunit delta -
  NKZ81_RS07965 (NKZ81_07965) - 1598652..1599242 (-) 591 WP_024402863.1 hypothetical protein -
  NKZ81_RS07970 (NKZ81_07970) - 1599355..1599717 (-) 363 Protein_1530 epoxyqueuosine reductase QueH -
  NKZ81_RS07975 (NKZ81_07975) - 1599807..1600517 (-) 711 WP_002937288.1 ABC transporter ATP-binding protein -
  NKZ81_RS07980 (NKZ81_07980) - 1600517..1601281 (-) 765 WP_029176900.1 ABC transporter ATP-binding protein -
  NKZ81_RS07985 (NKZ81_07985) - 1601281..1602228 (-) 948 WP_024378398.1 branched-chain amino acid ABC transporter permease -
  NKZ81_RS07990 (NKZ81_07990) - 1602231..1603118 (-) 888 WP_204101587.1 branched-chain amino acid ABC transporter permease -
  NKZ81_RS07995 (NKZ81_07995) - 1603314..1604483 (-) 1170 WP_044760026.1 ABC transporter substrate-binding protein -
  NKZ81_RS08000 (NKZ81_08000) - 1604615..1604887 (-) 273 WP_002937299.1 YlbG family protein -

Sequence


Protein


Download         Length: 153 a.a.        Molecular weight: 17061.73 Da        Isoelectric Point: 5.8552

>NTDB_id=704342 NKZ81_RS07830 WP_002937951.1 1581964..1582425(-) (ssb) [Streptococcus suis strain STC86]
MINNVVLVGRMTKDAELRYTPSNVAVATFTLAVNRNRKNENGEREADFINCVIWRQAAENLANWAKKGALIGIVGSIQTR
NYENQQGQRVYVTEVIANQFHMLESRGQQSQGNSFQNGNNSNSGNFQNGNNQGYQSPFGNSNPMDISDDDLPF

Nucleotide


Download         Length: 462 bp        

>NTDB_id=704342 NKZ81_RS07830 WP_002937951.1 1581964..1582425(-) (ssb) [Streptococcus suis strain STC86]
ATGATTAACAATGTTGTACTGGTTGGAAGAATGACCAAGGACGCTGAACTTAGATACACGCCATCTAATGTAGCGGTAGC
AACGTTCACTCTTGCTGTCAATCGCAACCGTAAAAATGAAAATGGTGAGCGTGAGGCTGATTTTATTAACTGTGTCATTT
GGAGACAGGCAGCCGAAAACTTAGCAAACTGGGCTAAGAAAGGTGCTCTGATCGGGATTGTAGGTAGTATCCAAACTAGG
AACTACGAAAACCAACAGGGTCAGCGTGTCTATGTGACTGAGGTTATTGCTAATCAGTTTCACATGCTAGAAAGCCGTGG
ACAACAGAGCCAGGGCAACTCTTTCCAAAATGGAAACAACTCAAACAGTGGTAATTTCCAAAACGGAAACAACCAAGGTT
ATCAGTCTCCATTTGGTAACTCAAACCCTATGGACATCTCTGATGATGACCTGCCTTTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

56.471

100

0.627

  ssbA Bacillus subtilis subsp. subtilis str. 168

55.172

100

0.627

  ssbB Bacillus subtilis subsp. subtilis str. 168

51.327

73.856

0.379

  ssb Vibrio cholerae strain A1552

32.759

100

0.373

  ssb Glaesserella parasuis strain SC1401

30.769

100

0.366