Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | M8331_RS02665 | Genome accession | NZ_CP097604 |
| Coordinates | 585383..585832 (-) | Length | 149 a.a. |
| NCBI ID | WP_083002355.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain 10159 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 581648..632590 | 585383..585832 | within | 0 |
Gene organization within MGE regions
Location: 581648..632590
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8331_RS02640 (M8331_02640) | - | 581648..581857 (+) | 210 | WP_005716039.1 | cold-shock protein | - |
| M8331_RS02645 (M8331_02645) | - | 581965..582375 (+) | 411 | Protein_498 | antitermination protein | - |
| M8331_RS02650 (M8331_02650) | - | 582479..583690 (-) | 1212 | WP_083002359.1 | integrase arm-type DNA-binding domain-containing protein | - |
| M8331_RS02655 (M8331_02655) | - | 583999..584196 (-) | 198 | WP_014391107.1 | hypothetical protein | - |
| M8331_RS02660 (M8331_02660) | - | 584256..585281 (-) | 1026 | WP_083002357.1 | FRG domain-containing protein | - |
| M8331_RS02665 (M8331_02665) | ssb | 585383..585832 (-) | 450 | WP_083002355.1 | single-stranded DNA-binding protein | Machinery gene |
| M8331_RS02670 (M8331_02670) | - | 585843..586544 (-) | 702 | WP_083002352.1 | ERF family protein | - |
| M8331_RS02675 (M8331_02675) | - | 586587..587237 (-) | 651 | WP_083002350.1 | ribonuclease H-like domain-containing protein | - |
| M8331_RS02680 (M8331_02680) | - | 587410..587571 (-) | 162 | WP_193757061.1 | hypothetical protein | - |
| M8331_RS02685 (M8331_02685) | - | 587581..587823 (-) | 243 | WP_083002348.1 | hypothetical protein | - |
| M8331_RS02690 (M8331_02690) | - | 587908..588519 (-) | 612 | WP_083002345.1 | KilA-N domain-containing protein | - |
| M8331_RS02695 (M8331_02695) | - | 588789..589616 (-) | 828 | WP_083002342.1 | BRO family protein | - |
| M8331_RS02700 (M8331_02700) | - | 589704..590729 (-) | 1026 | WP_083002339.1 | hypothetical protein | - |
| M8331_RS02705 (M8331_02705) | - | 590814..591782 (-) | 969 | WP_083002337.1 | reverse transcriptase family protein | - |
| M8331_RS02710 (M8331_02710) | - | 591757..592068 (-) | 312 | WP_083002334.1 | helix-turn-helix transcriptional regulator | - |
| M8331_RS02715 (M8331_02715) | - | 593080..593307 (-) | 228 | WP_083002331.1 | hypothetical protein | - |
| M8331_RS02720 (M8331_02720) | - | 593549..593758 (-) | 210 | WP_005756656.1 | hypothetical protein | - |
| M8331_RS02725 (M8331_02725) | - | 593771..593938 (+) | 168 | WP_005756653.1 | DUF1508 domain-containing protein | - |
| M8331_RS02730 (M8331_02730) | - | 594247..594561 (+) | 315 | WP_083002329.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| M8331_RS02735 (M8331_02735) | - | 594558..594848 (+) | 291 | WP_083002326.1 | addiction module antidote protein | - |
| M8331_RS02740 (M8331_02740) | - | 594874..595713 (-) | 840 | WP_083002324.1 | BRO family protein | - |
| M8331_RS02745 (M8331_02745) | - | 595805..596491 (-) | 687 | WP_083002321.1 | XRE family transcriptional regulator | - |
| M8331_RS02750 (M8331_02750) | - | 596619..596828 (+) | 210 | WP_005720263.1 | helix-turn-helix transcriptional regulator | - |
| M8331_RS02755 (M8331_02755) | - | 596901..597329 (+) | 429 | WP_250190967.1 | phage regulatory CII family protein | - |
| M8331_RS02760 (M8331_02760) | - | 597332..597739 (-) | 408 | WP_227718008.1 | hypothetical protein | - |
| M8331_RS02765 (M8331_02765) | - | 597851..598081 (+) | 231 | WP_083002312.1 | helix-turn-helix domain-containing protein | - |
| M8331_RS02770 (M8331_02770) | - | 598174..599034 (+) | 861 | WP_083002309.1 | DNA replication protein | - |
| M8331_RS02775 (M8331_02775) | - | 599034..600473 (+) | 1440 | WP_250190968.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| M8331_RS02780 (M8331_02780) | - | 600477..600902 (+) | 426 | WP_083002302.1 | recombination protein NinB | - |
| M8331_RS02785 (M8331_02785) | - | 600976..601578 (+) | 603 | WP_083002299.1 | recombination protein NinG | - |
| M8331_RS02790 (M8331_02790) | - | 601579..602040 (+) | 462 | WP_083002297.1 | antiterminator Q family protein | - |
| M8331_RS02795 (M8331_02795) | - | 602165..602728 (-) | 564 | WP_083002295.1 | hypothetical protein | - |
| M8331_RS02800 (M8331_02800) | - | 602846..603142 (+) | 297 | WP_081273045.1 | hypothetical protein | - |
| M8331_RS02805 (M8331_02805) | - | 603139..603669 (+) | 531 | WP_083002292.1 | lysozyme | - |
| M8331_RS02810 (M8331_02810) | - | 603642..603965 (+) | 324 | WP_083002289.1 | DUF2570 family protein | - |
| M8331_RS02815 (M8331_02815) | - | 603979..604152 (+) | 174 | WP_227718007.1 | lytic protein Rz1 | - |
| M8331_RS02820 (M8331_02820) | - | 604175..604543 (-) | 369 | WP_014391478.1 | helix-turn-helix transcriptional regulator | - |
| M8331_RS02825 (M8331_02825) | - | 604579..604839 (-) | 261 | WP_064702795.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| M8331_RS02830 (M8331_02830) | - | 605120..605599 (+) | 480 | WP_083002285.1 | DUF1441 family protein | - |
| M8331_RS02835 (M8331_02835) | - | 605599..607710 (+) | 2112 | WP_083002282.1 | phage terminase large subunit family protein | - |
| M8331_RS02840 (M8331_02840) | - | 607707..607931 (+) | 225 | WP_083002279.1 | hypothetical protein | - |
| M8331_RS02845 (M8331_02845) | - | 608015..608176 (+) | 162 | WP_167383052.1 | hypothetical protein | - |
| M8331_RS02850 (M8331_02850) | - | 608201..609718 (+) | 1518 | Protein_539 | phage portal protein | - |
| M8331_RS02855 (M8331_02855) | - | 609687..611690 (+) | 2004 | WP_227718031.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| M8331_RS02860 (M8331_02860) | - | 611758..612084 (+) | 327 | WP_083002274.1 | capsid cement protein | - |
| M8331_RS02865 (M8331_02865) | - | 612077..612379 (+) | 303 | WP_083002271.1 | phage tail protein | - |
| M8331_RS02870 (M8331_02870) | - | 612383..612910 (+) | 528 | WP_083002269.1 | phage tail protein | - |
| M8331_RS02875 (M8331_02875) | gpU | 612910..613320 (+) | 411 | WP_083002267.1 | phage tail terminator protein | - |
| M8331_RS02880 (M8331_02880) | - | 613320..613970 (+) | 651 | WP_083002264.1 | hypothetical protein | - |
| M8331_RS02885 (M8331_02885) | - | 614026..614418 (+) | 393 | WP_083002262.1 | hypothetical protein | - |
| M8331_RS02890 (M8331_02890) | - | 614487..614714 (+) | 228 | WP_083005723.1 | DUF4035 domain-containing protein | - |
| M8331_RS02895 (M8331_02895) | - | 614796..615341 (+) | 546 | WP_083002260.1 | hypothetical protein | - |
| M8331_RS02900 (M8331_02900) | - | 615705..616223 (+) | 519 | WP_083002258.1 | hypothetical protein | - |
| M8331_RS02905 (M8331_02905) | - | 616225..616719 (+) | 495 | WP_083002255.1 | type VI secretion system-associated protein TagO | - |
| M8331_RS02910 (M8331_02910) | - | 616881..618839 (+) | 1959 | WP_083002252.1 | ATP-binding protein | - |
| M8331_RS02915 (M8331_02915) | - | 619144..619815 (+) | 672 | WP_250190969.1 | KilA-N domain-containing protein | - |
| M8331_RS02920 (M8331_02920) | - | 619870..620223 (+) | 354 | WP_083002247.1 | DUF2513 domain-containing protein | - |
| M8331_RS02925 (M8331_02925) | - | 620282..620533 (+) | 252 | WP_083002244.1 | hypothetical protein | - |
| M8331_RS02930 (M8331_02930) | - | 620592..623873 (+) | 3282 | WP_083002241.1 | tape measure protein | - |
| M8331_RS02935 (M8331_02935) | - | 623870..624298 (+) | 429 | WP_227718006.1 | phage tail protein | - |
| M8331_RS02940 (M8331_02940) | - | 624291..625106 (+) | 816 | WP_083002238.1 | collagen-like protein | - |
| M8331_RS02945 (M8331_02945) | - | 625115..625699 (+) | 585 | WP_083002236.1 | DUF4376 domain-containing protein | - |
| M8331_RS02950 (M8331_02950) | - | 625686..625952 (+) | 267 | WP_083002233.1 | DNA helicase UvrD | - |
| M8331_RS02955 (M8331_02955) | - | 625961..626674 (+) | 714 | WP_083002230.1 | phage minor tail protein L | - |
| M8331_RS02960 (M8331_02960) | - | 626677..627411 (+) | 735 | WP_083002227.1 | C40 family peptidase | - |
| M8331_RS02965 (M8331_02965) | - | 627354..627977 (+) | 624 | WP_250190970.1 | tail assembly protein | - |
| M8331_RS02970 (M8331_02970) | - | 627981..631322 (+) | 3342 | WP_083002222.1 | phage tail protein | - |
| M8331_RS02975 (M8331_02975) | - | 631343..632590 (-) | 1248 | WP_250190971.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 16773.58 Da Isoelectric Point: 6.9823
>NTDB_id=691057 M8331_RS02665 WP_083002355.1 585383..585832(-) (ssb) [Pasteurella multocida strain 10159]
MAGVNKVIIVGNLGNDPDVRTMPNGEAVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQPQAPAPQNNAYANAKAGKPAQQQADSFEDDNIPF
MAGVNKVIIVGNLGNDPDVRTMPNGEAVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQPQAPAPQNNAYANAKAGKPAQQQADSFEDDNIPF
Nucleotide
Download Length: 450 bp
>NTDB_id=691057 M8331_RS02665 WP_083002355.1 585383..585832(-) (ssb) [Pasteurella multocida strain 10159]
ATGGCTGGAGTAAATAAAGTAATTATAGTCGGGAATTTAGGAAACGATCCTGATGTCCGCACAATGCCAAATGGCGAAGC
AGTGGCAAAAATCAGCGTCGCAACTAGTGAAAGCTGGATAGACAAAAACACGAACGAGCGCAAAACACAAACTGAATGGC
ACTCTATCGTGTTCTATCGCAGACAAGCAGAAATTTGCGGCCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGATCGCTACACAACTGAAATCCAAGGTGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCGCAACCGCAAGCACCGGCACCACAAAACAACGCTTATGCAAATGCGAAAGCTGGAAAGC
CAGCACAGCAACAAGCAGATAGCTTTGAAGACGACAATATACCGTTCTGA
ATGGCTGGAGTAAATAAAGTAATTATAGTCGGGAATTTAGGAAACGATCCTGATGTCCGCACAATGCCAAATGGCGAAGC
AGTGGCAAAAATCAGCGTCGCAACTAGTGAAAGCTGGATAGACAAAAACACGAACGAGCGCAAAACACAAACTGAATGGC
ACTCTATCGTGTTCTATCGCAGACAAGCAGAAATTTGCGGCCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGATCGCTACACAACTGAAATCCAAGGTGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCGCAACCGCAAGCACCGGCACCACAAAACAACGCTTATGCAAATGCGAAAGCTGGAAAGC
CAGCACAGCAACAAGCAGATAGCTTTGAAGACGACAATATACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
62.983 |
100 |
0.765 |
| ssb | Vibrio cholerae strain A1552 |
47.399 |
100 |
0.55 |
| ssb | Neisseria meningitidis MC58 |
48.507 |
89.933 |
0.436 |
| ssb | Neisseria gonorrhoeae MS11 |
48.507 |
89.933 |
0.436 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
31.395 |
100 |
0.362 |