Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   M8331_RS02665 Genome accession   NZ_CP097604
Coordinates   585383..585832 (-) Length   149 a.a.
NCBI ID   WP_083002355.1    Uniprot ID   -
Organism   Pasteurella multocida strain 10159     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 581648..632590 585383..585832 within 0


Gene organization within MGE regions


Location: 581648..632590
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8331_RS02640 (M8331_02640) - 581648..581857 (+) 210 WP_005716039.1 cold-shock protein -
  M8331_RS02645 (M8331_02645) - 581965..582375 (+) 411 Protein_498 antitermination protein -
  M8331_RS02650 (M8331_02650) - 582479..583690 (-) 1212 WP_083002359.1 integrase arm-type DNA-binding domain-containing protein -
  M8331_RS02655 (M8331_02655) - 583999..584196 (-) 198 WP_014391107.1 hypothetical protein -
  M8331_RS02660 (M8331_02660) - 584256..585281 (-) 1026 WP_083002357.1 FRG domain-containing protein -
  M8331_RS02665 (M8331_02665) ssb 585383..585832 (-) 450 WP_083002355.1 single-stranded DNA-binding protein Machinery gene
  M8331_RS02670 (M8331_02670) - 585843..586544 (-) 702 WP_083002352.1 ERF family protein -
  M8331_RS02675 (M8331_02675) - 586587..587237 (-) 651 WP_083002350.1 ribonuclease H-like domain-containing protein -
  M8331_RS02680 (M8331_02680) - 587410..587571 (-) 162 WP_193757061.1 hypothetical protein -
  M8331_RS02685 (M8331_02685) - 587581..587823 (-) 243 WP_083002348.1 hypothetical protein -
  M8331_RS02690 (M8331_02690) - 587908..588519 (-) 612 WP_083002345.1 KilA-N domain-containing protein -
  M8331_RS02695 (M8331_02695) - 588789..589616 (-) 828 WP_083002342.1 BRO family protein -
  M8331_RS02700 (M8331_02700) - 589704..590729 (-) 1026 WP_083002339.1 hypothetical protein -
  M8331_RS02705 (M8331_02705) - 590814..591782 (-) 969 WP_083002337.1 reverse transcriptase family protein -
  M8331_RS02710 (M8331_02710) - 591757..592068 (-) 312 WP_083002334.1 helix-turn-helix transcriptional regulator -
  M8331_RS02715 (M8331_02715) - 593080..593307 (-) 228 WP_083002331.1 hypothetical protein -
  M8331_RS02720 (M8331_02720) - 593549..593758 (-) 210 WP_005756656.1 hypothetical protein -
  M8331_RS02725 (M8331_02725) - 593771..593938 (+) 168 WP_005756653.1 DUF1508 domain-containing protein -
  M8331_RS02730 (M8331_02730) - 594247..594561 (+) 315 WP_083002329.1 type II toxin-antitoxin system RelE/ParE family toxin -
  M8331_RS02735 (M8331_02735) - 594558..594848 (+) 291 WP_083002326.1 addiction module antidote protein -
  M8331_RS02740 (M8331_02740) - 594874..595713 (-) 840 WP_083002324.1 BRO family protein -
  M8331_RS02745 (M8331_02745) - 595805..596491 (-) 687 WP_083002321.1 XRE family transcriptional regulator -
  M8331_RS02750 (M8331_02750) - 596619..596828 (+) 210 WP_005720263.1 helix-turn-helix transcriptional regulator -
  M8331_RS02755 (M8331_02755) - 596901..597329 (+) 429 WP_250190967.1 phage regulatory CII family protein -
  M8331_RS02760 (M8331_02760) - 597332..597739 (-) 408 WP_227718008.1 hypothetical protein -
  M8331_RS02765 (M8331_02765) - 597851..598081 (+) 231 WP_083002312.1 helix-turn-helix domain-containing protein -
  M8331_RS02770 (M8331_02770) - 598174..599034 (+) 861 WP_083002309.1 DNA replication protein -
  M8331_RS02775 (M8331_02775) - 599034..600473 (+) 1440 WP_250190968.1 DnaB-like helicase C-terminal domain-containing protein -
  M8331_RS02780 (M8331_02780) - 600477..600902 (+) 426 WP_083002302.1 recombination protein NinB -
  M8331_RS02785 (M8331_02785) - 600976..601578 (+) 603 WP_083002299.1 recombination protein NinG -
  M8331_RS02790 (M8331_02790) - 601579..602040 (+) 462 WP_083002297.1 antiterminator Q family protein -
  M8331_RS02795 (M8331_02795) - 602165..602728 (-) 564 WP_083002295.1 hypothetical protein -
  M8331_RS02800 (M8331_02800) - 602846..603142 (+) 297 WP_081273045.1 hypothetical protein -
  M8331_RS02805 (M8331_02805) - 603139..603669 (+) 531 WP_083002292.1 lysozyme -
  M8331_RS02810 (M8331_02810) - 603642..603965 (+) 324 WP_083002289.1 DUF2570 family protein -
  M8331_RS02815 (M8331_02815) - 603979..604152 (+) 174 WP_227718007.1 lytic protein Rz1 -
  M8331_RS02820 (M8331_02820) - 604175..604543 (-) 369 WP_014391478.1 helix-turn-helix transcriptional regulator -
  M8331_RS02825 (M8331_02825) - 604579..604839 (-) 261 WP_064702795.1 type II toxin-antitoxin system RelE/ParE family toxin -
  M8331_RS02830 (M8331_02830) - 605120..605599 (+) 480 WP_083002285.1 DUF1441 family protein -
  M8331_RS02835 (M8331_02835) - 605599..607710 (+) 2112 WP_083002282.1 phage terminase large subunit family protein -
  M8331_RS02840 (M8331_02840) - 607707..607931 (+) 225 WP_083002279.1 hypothetical protein -
  M8331_RS02845 (M8331_02845) - 608015..608176 (+) 162 WP_167383052.1 hypothetical protein -
  M8331_RS02850 (M8331_02850) - 608201..609718 (+) 1518 Protein_539 phage portal protein -
  M8331_RS02855 (M8331_02855) - 609687..611690 (+) 2004 WP_227718031.1 ClpP-like prohead protease/major capsid protein fusion protein -
  M8331_RS02860 (M8331_02860) - 611758..612084 (+) 327 WP_083002274.1 capsid cement protein -
  M8331_RS02865 (M8331_02865) - 612077..612379 (+) 303 WP_083002271.1 phage tail protein -
  M8331_RS02870 (M8331_02870) - 612383..612910 (+) 528 WP_083002269.1 phage tail protein -
  M8331_RS02875 (M8331_02875) gpU 612910..613320 (+) 411 WP_083002267.1 phage tail terminator protein -
  M8331_RS02880 (M8331_02880) - 613320..613970 (+) 651 WP_083002264.1 hypothetical protein -
  M8331_RS02885 (M8331_02885) - 614026..614418 (+) 393 WP_083002262.1 hypothetical protein -
  M8331_RS02890 (M8331_02890) - 614487..614714 (+) 228 WP_083005723.1 DUF4035 domain-containing protein -
  M8331_RS02895 (M8331_02895) - 614796..615341 (+) 546 WP_083002260.1 hypothetical protein -
  M8331_RS02900 (M8331_02900) - 615705..616223 (+) 519 WP_083002258.1 hypothetical protein -
  M8331_RS02905 (M8331_02905) - 616225..616719 (+) 495 WP_083002255.1 type VI secretion system-associated protein TagO -
  M8331_RS02910 (M8331_02910) - 616881..618839 (+) 1959 WP_083002252.1 ATP-binding protein -
  M8331_RS02915 (M8331_02915) - 619144..619815 (+) 672 WP_250190969.1 KilA-N domain-containing protein -
  M8331_RS02920 (M8331_02920) - 619870..620223 (+) 354 WP_083002247.1 DUF2513 domain-containing protein -
  M8331_RS02925 (M8331_02925) - 620282..620533 (+) 252 WP_083002244.1 hypothetical protein -
  M8331_RS02930 (M8331_02930) - 620592..623873 (+) 3282 WP_083002241.1 tape measure protein -
  M8331_RS02935 (M8331_02935) - 623870..624298 (+) 429 WP_227718006.1 phage tail protein -
  M8331_RS02940 (M8331_02940) - 624291..625106 (+) 816 WP_083002238.1 collagen-like protein -
  M8331_RS02945 (M8331_02945) - 625115..625699 (+) 585 WP_083002236.1 DUF4376 domain-containing protein -
  M8331_RS02950 (M8331_02950) - 625686..625952 (+) 267 WP_083002233.1 DNA helicase UvrD -
  M8331_RS02955 (M8331_02955) - 625961..626674 (+) 714 WP_083002230.1 phage minor tail protein L -
  M8331_RS02960 (M8331_02960) - 626677..627411 (+) 735 WP_083002227.1 C40 family peptidase -
  M8331_RS02965 (M8331_02965) - 627354..627977 (+) 624 WP_250190970.1 tail assembly protein -
  M8331_RS02970 (M8331_02970) - 627981..631322 (+) 3342 WP_083002222.1 phage tail protein -
  M8331_RS02975 (M8331_02975) - 631343..632590 (-) 1248 WP_250190971.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 149 a.a.        Molecular weight: 16773.58 Da        Isoelectric Point: 6.9823

>NTDB_id=691057 M8331_RS02665 WP_083002355.1 585383..585832(-) (ssb) [Pasteurella multocida strain 10159]
MAGVNKVIIVGNLGNDPDVRTMPNGEAVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQPQAPAPQNNAYANAKAGKPAQQQADSFEDDNIPF

Nucleotide


Download         Length: 450 bp        

>NTDB_id=691057 M8331_RS02665 WP_083002355.1 585383..585832(-) (ssb) [Pasteurella multocida strain 10159]
ATGGCTGGAGTAAATAAAGTAATTATAGTCGGGAATTTAGGAAACGATCCTGATGTCCGCACAATGCCAAATGGCGAAGC
AGTGGCAAAAATCAGCGTCGCAACTAGTGAAAGCTGGATAGACAAAAACACGAACGAGCGCAAAACACAAACTGAATGGC
ACTCTATCGTGTTCTATCGCAGACAAGCAGAAATTTGCGGCCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGATCGCTACACAACTGAAATCCAAGGTGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCGCAACCGCAAGCACCGGCACCACAAAACAACGCTTATGCAAATGCGAAAGCTGGAAAGC
CAGCACAGCAACAAGCAGATAGCTTTGAAGACGACAATATACCGTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

62.983

100

0.765

  ssb Vibrio cholerae strain A1552

47.399

100

0.55

  ssb Neisseria meningitidis MC58

48.507

89.933

0.436

  ssb Neisseria gonorrhoeae MS11

48.507

89.933

0.436

  ssb Latilactobacillus sakei subsp. sakei 23K

31.395

100

0.362