Detailed information NTG0689855

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: M8Z95_RS06000
• Genome accession: NZ_CP097519
• Coordinates: 1261561..1261878 (+)
• Length: 105 a.a.
• NCBI ID: WP_250070060.1
• Uniprot ID: -
• Organism: Staphylococcus epidermidis strain C066
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1256561..1266878

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
M8Z95_RS05970 (M8Z95_05970)	-	1257338..1257538 (+)	201	WP_001831138.1	YqgQ family protein	-
M8Z95_RS05975 (M8Z95_05975)	-	1257538..1258524 (+)	987	WP_001831113.1	ROK family glucokinase	-
M8Z95_RS05980 (M8Z95_05980)	-	1258524..1258850 (+)	327	WP_001831234.1	MTH1187 family thiamine-binding protein	-
M8Z95_RS05985 (M8Z95_05985)	-	1258850..1259473 (+)	624	WP_001831016.1	MBL fold metallo-hydrolase	-
M8Z95_RS05990 (M8Z95_05990)	comGA	1259530..1260504 (+)	975	WP_001831109.1	competence type IV pilus ATPase ComGA	Machinery gene
M8Z95_RS05995 (M8Z95_05995)	comGB	1260476..1261543 (+)	1068	WP_001831131.1	competence type IV pilus assembly protein ComGB	Machinery gene
M8Z95_RS06000 (M8Z95_06000)	comGC	1261561..1261878 (+)	318	WP_250070060.1	competence type IV pilus major pilin ComGC	Machinery gene
M8Z95_RS06005 (M8Z95_06005)	comGD	1261868..1262305 (+)	438	WP_001831025.1	competence type IV pilus minor pilin ComGD	-
M8Z95_RS06010 (M8Z95_06010)	-	1262292..1262585 (+)	294	WP_001831116.1	hypothetical protein	-
M8Z95_RS06015 (M8Z95_06015)	-	1262509..1263000 (+)	492	WP_002440043.1	competence type IV pilus minor pilin ComGF	-
M8Z95_RS06020 (M8Z95_06020)	-	1263165..1263677 (+)	513	WP_002440040.1	shikimate kinase	-
M8Z95_RS06025 (M8Z95_06025)	gcvT	1263895..1264986 (+)	1092	WP_001831107.1	glycine cleavage system aminomethyltransferase GcvT	-
M8Z95_RS06030 (M8Z95_06030)	gcvPA	1265006..1266352 (+)	1347	WP_002456181.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11477.55 Da
• Isoelectric Point: 9.7429

>NTDB_id=689855 M8Z95_RS06000 WP_250070060.1 1261561..1261878(+) (comGC) [Staphylococcus epidermidis strain C066]
MKTLKLLKKTRAFTLIEMLLVLLIISLLLILIVPNIAKQTSHIQSTGCDAQVKMVNSQIEAYALKHNRNPSNIDDLVSDG
FIKEGQKTCKSGQTISIANGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=689855 M8Z95_RS06000 WP_250070060.1 1261561..1261878(+) (comGC) [Staphylococcus epidermidis strain C066]
ATGAAAACATTGAAATTATTGAAAAAAACACGAGCATTTACCTTGATAGAAATGCTTTTAGTATTACTAATAATAAGTTT
ATTGTTAATACTTATAGTTCCAAATATTGCAAAACAAACATCTCATATTCAGTCAACTGGATGTGATGCTCAAGTTAAAA
TGGTAAACAGTCAAATAGAAGCCTACGCTTTAAAACATAATCGCAACCCTTCTAATATTGATGATTTGGTTTCAGATGGT
TTTATAAAAGAAGGACAAAAAACATGTAAATCCGGTCAGACAATTAGTATTGCAAATGGAGAAGCAGTTGCCAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	86.275	97.143	0.838
comGC	Staphylococcus aureus MW2	86.275	97.143	0.838
comGC/cglC	Streptococcus mitis SK321	45.631	98.095	0.448
comGC/cglC	Streptococcus pneumoniae D39	45.745	89.524	0.41
comGC/cglC	Streptococcus pneumoniae R6	45.745	89.524	0.41
comGC/cglC	Streptococcus pneumoniae TIGR4	45.745	89.524	0.41
comGC/cglC	Streptococcus pneumoniae Rx1	45.745	89.524	0.41
comYC	Streptococcus mutans UA140	48.837	81.905	0.4
comYC	Streptococcus mutans UA159	48.837	81.905	0.4
comYC	Streptococcus gordonii str. Challis substr. CH1	47.674	81.905	0.39
comGC/cglC	Streptococcus mitis NCTC 12261	51.282	74.286	0.381
comGC	Lactococcus lactis subsp. cremoris KW2	48.78	78.095	0.381
comYC	Streptococcus suis isolate S10	50	74.286	0.371