Detailed information
Bioinformatically predicted
Overview
| Name | comW | Type | Regulator |
| Locus tag | KK0981_RS00110 | Genome accession | NZ_AP017971 |
| Coordinates | 22178..22414 (+) | Length | 78 a.a. |
| NCBI ID | WP_000939548.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain KK0981 | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 12180..62796 | 22178..22414 | within | 0 |
| IScluster/Tn | 20757..26195 | 22178..22414 | within | 0 |
Gene organization within MGE regions
Location: 12180..62796
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KK0981_RS00060 (KK0981_00130) | ftsH | 12180..14138 (+) | 1959 | WP_050209888.1 | ATP-dependent zinc metalloprotease FtsH | - |
| KK0981_RS00065 (KK0981_00140) | comX/comX2 | 14260..14739 (+) | 480 | WP_000588897.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| KK0981_RS00100 | - | 20242..21080 (+) | 839 | Protein_14 | IS630 family transposase | - |
| KK0981_RS00105 | - | 21115..21912 (-) | 798 | Protein_15 | transposase | - |
| KK0981_RS00110 (KK0981_00240) | comW | 22178..22414 (+) | 237 | WP_000939548.1 | sigma(X)-activator ComW | Regulator |
| KK0981_RS00115 (KK0981_00250) | - | 22645..23931 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| KK0981_RS00120 (KK0981_00260) | tadA | 24132..24599 (+) | 468 | WP_000291875.1 | tRNA adenosine(34) deaminase TadA | - |
| KK0981_RS00130 (KK0981_00270) | - | 24939..26195 (+) | 1257 | WP_096376093.1 | ISL3 family transposase | - |
| KK0981_RS00135 (KK0981_00280) | - | 26264..27400 (-) | 1137 | WP_001824497.1 | tyrosine-type recombinase/integrase | - |
| KK0981_RS00140 (KK0981_00290) | - | 27461..28531 (-) | 1071 | WP_000401841.1 | type I restriction endonuclease | - |
| KK0981_RS11600 | - | 28548..28924 (-) | 377 | Protein_22 | ImmA/IrrE family metallo-endopeptidase | - |
| KK0981_RS00150 (KK0981_00320) | - | 28937..29200 (-) | 264 | WP_000285962.1 | type II toxin-antitoxin system RelE family toxin | - |
| KK0981_RS00155 (KK0981_00330) | - | 29200..29433 (-) | 234 | WP_000156419.1 | hypothetical protein | - |
| KK0981_RS00160 (KK0981_00340) | - | 29433..29801 (-) | 369 | WP_000464160.1 | helix-turn-helix domain-containing protein | - |
| KK0981_RS00165 (KK0981_00360) | - | 30215..30454 (-) | 240 | WP_000142893.1 | hypothetical protein | - |
| KK0981_RS00170 (KK0981_00370) | - | 30519..30710 (+) | 192 | WP_001112859.1 | DNA-binding protein | - |
| KK0981_RS00175 (KK0981_00380) | - | 30733..30936 (+) | 204 | WP_001247549.1 | hypothetical protein | - |
| KK0981_RS00180 (KK0981_00400) | - | 31091..31258 (-) | 168 | WP_000024180.1 | YjzC family protein | - |
| KK0981_RS00185 (KK0981_00410) | - | 31263..31643 (+) | 381 | Protein_30 | autolysin | - |
| KK0981_RS00190 (KK0981_00420) | - | 31927..32370 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| KK0981_RS00195 (KK0981_00430) | - | 32372..32887 (+) | 516 | WP_001842035.1 | histidine phosphatase family protein | - |
| KK0981_RS00200 (KK0981_00440) | radA | 32901..34262 (+) | 1362 | WP_074017595.1 | DNA repair protein RadA | Machinery gene |
| KK0981_RS00205 (KK0981_00450) | - | 34335..34832 (+) | 498 | WP_001809263.1 | beta-class carbonic anhydrase | - |
| KK0981_RS00215 (KK0981_00470) | - | 34857..35671 (+) | 815 | Protein_35 | PrsW family intramembrane metalloprotease | - |
| KK0981_RS00220 (KK0981_00480) | - | 35816..36784 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| KK0981_RS00225 | - | 36921..37199 (-) | 279 | Protein_37 | transposase family protein | - |
| KK0981_RS12130 | - | 37326..38233 (-) | 908 | Protein_38 | Rpn family recombination-promoting nuclease/putative transposase | - |
| KK0981_RS00245 (KK0981_00520) | polA | 38489..41122 (+) | 2634 | WP_002202064.1 | DNA polymerase I | - |
| KK0981_RS00250 (KK0981_00530) | - | 41207..41644 (+) | 438 | WP_000076487.1 | CoA-binding protein | - |
| KK0981_RS12135 | - | 41685..41855 (+) | 171 | WP_050111560.1 | hypothetical protein | - |
| KK0981_RS00260 (KK0981_00540) | - | 41874..42884 (-) | 1011 | WP_000009170.1 | YeiH family protein | - |
| KK0981_RS00265 (KK0981_00550) | - | 43033..44202 (+) | 1170 | WP_000366342.1 | pyridoxal phosphate-dependent aminotransferase | - |
| KK0981_RS00270 (KK0981_00560) | recO | 44199..44969 (+) | 771 | WP_000616172.1 | DNA repair protein RecO | - |
| KK0981_RS00275 (KK0981_00570) | plsX | 44966..45958 (+) | 993 | WP_000717458.1 | phosphate acyltransferase PlsX | - |
| KK0981_RS00280 (KK0981_00580) | - | 45964..46197 (+) | 234 | WP_000136447.1 | acyl carrier protein | - |
| KK0981_RS00285 (KK0981_00590) | - | 46234..46533 (+) | 300 | Protein_47 | transposase family protein | - |
| KK0981_RS00290 (KK0981_00600) | blpU | 46736..46966 (+) | 231 | WP_001093069.1 | bacteriocin-like peptide BlpU | - |
| KK0981_RS12565 | - | 46969..47094 (+) | 126 | WP_001842754.1 | PncF family bacteriocin immunity protein | - |
| KK0981_RS00295 | - | 47418..48744 (-) | 1327 | Protein_50 | ISL3 family transposase | - |
| KK0981_RS00305 (KK0981_00640) | comA | 49176..51329 (+) | 2154 | WP_000668297.1 | peptide cleavage/export ABC transporter ComA | Regulator |
| KK0981_RS00310 (KK0981_00650) | comB | 51342..52691 (+) | 1350 | WP_000801609.1 | competence pheromone export protein ComB | Regulator |
| KK0981_RS00315 (KK0981_00660) | purC | 52861..53568 (+) | 708 | WP_000043302.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| KK0981_RS12640 | - | 53579..53713 (+) | 135 | WP_000429436.1 | hypothetical protein | - |
| KK0981_RS00325 (KK0981_00670) | - | 53770..57495 (+) | 3726 | WP_000361219.1 | phosphoribosylformylglycinamidine synthase | - |
| KK0981_RS00330 (KK0981_00680) | purF | 57588..59030 (+) | 1443 | WP_000220636.1 | amidophosphoribosyltransferase | - |
| KK0981_RS00335 (KK0981_00690) | purM | 59067..60089 (+) | 1023 | WP_096376094.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| KK0981_RS00340 (KK0981_00700) | purN | 60086..60631 (+) | 546 | WP_000717501.1 | phosphoribosylglycinamide formyltransferase | - |
| KK0981_RS00345 (KK0981_20950) | - | 60715..61224 (+) | 510 | WP_000894018.1 | VanZ family protein | - |
| KK0981_RS00350 (KK0981_20960) | purH | 61249..62796 (+) | 1548 | WP_000167076.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9716.17 Da Isoelectric Point: 6.7051
>NTDB_id=68660 KK0981_RS00110 WP_000939548.1 22178..22414(+) (comW) [Streptococcus pneumoniae strain KK0981]
MLQKIYEQMTNFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRRDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMTNFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRRDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=68660 KK0981_RS00110 WP_000939548.1 22178..22414(+) (comW) [Streptococcus pneumoniae strain KK0981]
ATGTTACAAAAAATTTATGAGCAGATGACTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGACTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae D39 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae R6 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae TIGR4 |
97.436 |
100 |
0.974 |
| comW | Streptococcus mitis SK321 |
76.923 |
100 |
0.769 |
| comW | Streptococcus mitis NCTC 12261 |
76.623 |
98.718 |
0.756 |