Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPPMSS1_RS07015 Genome accession   NZ_AP017633
Coordinates   1483938..1484051 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain PMSS1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1478938..1489051
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPPMSS1_RS06995 (HPATCC43504_RS07285) - 1479612..1481024 (-) 1413 WP_077231621.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  HPPMSS1_RS07000 (HPATCC43504_RS07290) comB10 1481095..1482225 (-) 1131 WP_077231620.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPPMSS1_RS07005 (HPATCC43504_RS07295) comB9 1482218..1483198 (-) 981 WP_077231619.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPPMSS1_RS07010 (HPATCC43504_RS07300) comB8 1483198..1483941 (-) 744 WP_001208396.1 virB8 family protein Machinery gene
  HPPMSS1_RS07015 (HPATCC43504_RS07305) comB7 1483938..1484051 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  HPPMSS1_RS07020 (HPATCC43504_RS07310) comB6 1484067..1485122 (-) 1056 WP_077231618.1 P-type conjugative transfer protein TrbL Machinery gene
  HPPMSS1_RS07025 (HPATCC43504_RS07315) - 1485130..1486125 (-) 996 WP_077231617.1 PDZ domain-containing protein -
  HPPMSS1_RS07030 (HPATCC43504_RS07320) - 1486125..1486427 (-) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  HPPMSS1_RS07035 (HPATCC43504_RS07325) panD 1486430..1486783 (-) 354 WP_000142235.1 aspartate 1-decarboxylase -
  HPPMSS1_RS07040 (HPATCC43504_RS07330) - 1486773..1488998 (-) 2226 WP_077231616.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=68300 HPPMSS1_RS07015 WP_001217873.1 1483938..1484051(-) (comB7) [Helicobacter pylori strain PMSS1]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=68300 HPPMSS1_RS07015 WP_001217873.1 1483938..1484051(-) (comB7) [Helicobacter pylori strain PMSS1]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment