Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | MUB28_RS01420 | Genome accession | NZ_CP094945 |
| Coordinates | 262272..262481 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain VHProbi R08 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 257272..267481
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUB28_RS01390 (MUB28_01390) | - | 257710..258219 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| MUB28_RS01395 (MUB28_01395) | - | 258531..259088 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| MUB28_RS01400 (MUB28_01400) | - | 259091..259741 (+) | 651 | WP_248857302.1 | phosphatase PAP2 family protein | - |
| MUB28_RS01405 (MUB28_01405) | comR | 259936..260835 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| MUB28_RS01410 (MUB28_01410) | - | 261073..261504 (+) | 432 | Protein_234 | cysteine peptidase family C39 domain-containing protein | - |
| MUB28_RS01415 (MUB28_01415) | - | 261534..262199 (+) | 666 | Protein_235 | ABC transporter transmembrane domain-containing protein | - |
| MUB28_RS01420 (MUB28_01420) | comA | 262272..262481 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| MUB28_RS01425 (MUB28_01425) | - | 262536..263104 (+) | 569 | Protein_237 | ATP-binding cassette domain-containing protein | - |
| MUB28_RS01430 (MUB28_01430) | - | 263212..263529 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| MUB28_RS01435 (MUB28_01435) | - | 263492..263776 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| MUB28_RS01440 (MUB28_01440) | - | 264016..264912 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| MUB28_RS01445 (MUB28_01445) | - | 265317..265832 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| MUB28_RS01450 (MUB28_01450) | - | 265857..266159 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| MUB28_RS01455 (MUB28_01455) | - | 266171..266482 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=674389 MUB28_RS01420 WP_002946147.1 262272..262481(+) (comA) [Streptococcus thermophilus strain VHProbi R08]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=674389 MUB28_RS01420 WP_002946147.1 262272..262481(+) (comA) [Streptococcus thermophilus strain VHProbi R08]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |