Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | MUA82_RS08235 | Genome accession | NZ_CP094709 |
| Coordinates | 1692707..1693153 (-) | Length | 148 a.a. |
| NCBI ID | WP_262582885.1 | Uniprot ID | - |
| Organism | Staphylococcus simulans strain IVB6174 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1657492..1701244 | 1692707..1693153 | within | 0 |
Gene organization within MGE regions
Location: 1657492..1701244
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA82_RS07995 (MUA82_07995) | - | 1657492..1657680 (-) | 189 | WP_031262571.1 | hypothetical protein | - |
| MUA82_RS08000 | - | 1657866..1658000 (-) | 135 | WP_262556842.1 | hypothetical protein | - |
| MUA82_RS08005 (MUA82_08000) | - | 1658614..1660044 (-) | 1431 | WP_262582844.1 | SH3 domain-containing protein | - |
| MUA82_RS08010 (MUA82_08005) | - | 1660025..1660447 (-) | 423 | WP_262582845.1 | phage holin | - |
| MUA82_RS08015 | - | 1660498..1662495 (-) | 1998 | WP_262582846.1 | BppU family phage baseplate upper protein | - |
| MUA82_RS08020 (MUA82_08015) | - | 1662508..1664427 (-) | 1920 | WP_262582848.1 | glucosaminidase domain-containing protein | - |
| MUA82_RS08025 (MUA82_08020) | - | 1664477..1664866 (-) | 390 | WP_002480816.1 | hypothetical protein | - |
| MUA82_RS08030 (MUA82_08025) | - | 1664859..1665302 (-) | 444 | WP_262582850.1 | hypothetical protein | - |
| MUA82_RS08035 (MUA82_08030) | - | 1665314..1665448 (-) | 135 | WP_002480814.1 | XkdX family protein | - |
| MUA82_RS08040 (MUA82_08035) | - | 1665438..1665800 (-) | 363 | WP_002480813.1 | hypothetical protein | - |
| MUA82_RS08045 (MUA82_08040) | - | 1665814..1667310 (-) | 1497 | WP_262582852.1 | BppU family phage baseplate upper protein | - |
| MUA82_RS08050 (MUA82_08045) | - | 1667303..1669966 (-) | 2664 | WP_002480811.1 | peptidase G2 autoproteolytic cleavage domain-containing protein | - |
| MUA82_RS08055 (MUA82_08050) | - | 1669969..1671471 (-) | 1503 | WP_262582853.1 | phage tail protein | - |
| MUA82_RS08060 (MUA82_08055) | - | 1671480..1672394 (-) | 915 | WP_262582855.1 | phage tail family protein | - |
| MUA82_RS08065 (MUA82_08060) | - | 1672413..1675643 (-) | 3231 | WP_262582856.1 | terminase | - |
| MUA82_RS08070 (MUA82_08065) | - | 1675654..1675929 (-) | 276 | WP_047132646.1 | hypothetical protein | - |
| MUA82_RS08075 (MUA82_08070) | - | 1675995..1676492 (-) | 498 | WP_002480806.1 | tail assembly chaperone | - |
| MUA82_RS08080 (MUA82_08075) | - | 1676550..1677113 (-) | 564 | WP_047132645.1 | phage major tail protein, TP901-1 family | - |
| MUA82_RS08085 (MUA82_08080) | - | 1677117..1677539 (-) | 423 | WP_015978135.1 | DUF3168 domain-containing protein | - |
| MUA82_RS08090 (MUA82_08085) | - | 1677550..1677708 (-) | 159 | Protein_1568 | HK97 gp10 family phage protein | - |
| MUA82_RS08095 (MUA82_08090) | - | 1677900..1678583 (-) | 684 | WP_262582859.1 | hypothetical protein | - |
| MUA82_RS08100 (MUA82_08095) | - | 1678712..1678966 (-) | 255 | Protein_1570 | HK97 gp10 family phage protein | - |
| MUA82_RS08105 (MUA82_08100) | - | 1678959..1679288 (-) | 330 | WP_262582860.1 | phage head closure protein | - |
| MUA82_RS08110 (MUA82_08105) | - | 1679290..1679586 (-) | 297 | WP_262582861.1 | phage head-tail connector protein | - |
| MUA82_RS08115 (MUA82_08110) | - | 1679586..1679867 (-) | 282 | WP_262582862.1 | Rho termination factor N-terminal domain-containing protein | - |
| MUA82_RS08120 (MUA82_08115) | - | 1679880..1680704 (-) | 825 | WP_262582863.1 | N4-gp56 family major capsid protein | - |
| MUA82_RS08125 (MUA82_08120) | - | 1680723..1681319 (-) | 597 | WP_262582864.1 | phage scaffolding protein | - |
| MUA82_RS08130 (MUA82_08125) | - | 1681430..1682380 (-) | 951 | WP_262582865.1 | phage head morphogenesis protein | - |
| MUA82_RS08135 (MUA82_08130) | - | 1682337..1683773 (-) | 1437 | WP_262582866.1 | phage portal protein | - |
| MUA82_RS08140 (MUA82_08135) | - | 1683779..1685038 (-) | 1260 | WP_262582867.1 | PBSX family phage terminase large subunit | - |
| MUA82_RS08145 (MUA82_08140) | - | 1685038..1685415 (-) | 378 | WP_107529536.1 | DNA-binding protein | - |
| MUA82_RS08150 (MUA82_08145) | - | 1685607..1686032 (-) | 426 | WP_262582868.1 | transcriptional regulator | - |
| MUA82_RS08155 (MUA82_08150) | rinB | 1686171..1686332 (-) | 162 | WP_262582870.1 | transcriptional activator RinB | - |
| MUA82_RS08160 (MUA82_08155) | - | 1686336..1686512 (-) | 177 | WP_262582871.1 | hypothetical protein | - |
| MUA82_RS08165 (MUA82_08160) | - | 1686860..1687366 (-) | 507 | WP_262582872.1 | dUTP diphosphatase | - |
| MUA82_RS08170 (MUA82_08165) | - | 1687359..1687556 (-) | 198 | WP_262582874.1 | hypothetical protein | - |
| MUA82_RS08175 (MUA82_08170) | - | 1687549..1687716 (-) | 168 | WP_262583439.1 | hypothetical protein | - |
| MUA82_RS08180 (MUA82_08175) | - | 1687713..1687922 (-) | 210 | WP_262582875.1 | hypothetical protein | - |
| MUA82_RS08185 (MUA82_08180) | - | 1687907..1688182 (-) | 276 | WP_262582876.1 | hypothetical protein | - |
| MUA82_RS08190 (MUA82_08185) | - | 1688163..1688366 (-) | 204 | WP_107597131.1 | hypothetical protein | - |
| MUA82_RS08195 (MUA82_08190) | - | 1688367..1688822 (-) | 456 | WP_262582878.1 | DUF3310 domain-containing protein | - |
| MUA82_RS08200 (MUA82_08195) | - | 1688822..1689337 (-) | 516 | WP_262582879.1 | SA1788 family PVL leukocidin-associated protein | - |
| MUA82_RS08205 (MUA82_08200) | - | 1689351..1689542 (-) | 192 | WP_262582880.1 | hypothetical protein | - |
| MUA82_RS08210 (MUA82_08205) | - | 1689543..1689950 (-) | 408 | WP_262582881.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MUA82_RS08215 (MUA82_08210) | - | 1690116..1690889 (-) | 774 | WP_262582882.1 | ATP-binding protein | - |
| MUA82_RS08220 (MUA82_08215) | - | 1690902..1691684 (-) | 783 | WP_023015637.1 | conserved phage C-terminal domain-containing protein | - |
| MUA82_RS08225 (MUA82_08220) | - | 1691677..1692024 (-) | 348 | WP_262582883.1 | hypothetical protein | - |
| MUA82_RS08230 (MUA82_08225) | - | 1692017..1692694 (-) | 678 | WP_262582884.1 | putative HNHc nuclease | - |
| MUA82_RS08235 (MUA82_08230) | ssb | 1692707..1693153 (-) | 447 | WP_262582885.1 | single-stranded DNA-binding protein | Machinery gene |
| MUA82_RS08240 (MUA82_08235) | - | 1693153..1693823 (-) | 671 | Protein_1598 | ERF family protein | - |
| MUA82_RS08245 (MUA82_08240) | - | 1693823..1694308 (-) | 486 | WP_262582886.1 | siphovirus Gp157 family protein | - |
| MUA82_RS08250 (MUA82_08245) | - | 1694311..1694577 (-) | 267 | WP_262582887.1 | DUF1108 family protein | - |
| MUA82_RS08255 (MUA82_08250) | - | 1694675..1694890 (-) | 216 | WP_262578477.1 | hypothetical protein | - |
| MUA82_RS08260 (MUA82_08255) | - | 1694903..1695205 (-) | 303 | WP_002480770.1 | DUF771 domain-containing protein | - |
| MUA82_RS08265 (MUA82_08260) | - | 1695255..1695752 (+) | 498 | WP_262582888.1 | hypothetical protein | - |
| MUA82_RS08270 (MUA82_08265) | - | 1695861..1696100 (+) | 240 | WP_057510934.1 | hypothetical protein | - |
| MUA82_RS08275 (MUA82_08270) | - | 1696090..1696269 (-) | 180 | WP_057510935.1 | hypothetical protein | - |
| MUA82_RS08280 (MUA82_08275) | - | 1696284..1697051 (-) | 768 | WP_262582889.1 | phage regulatory protein/antirepressor Ant | - |
| MUA82_RS08285 (MUA82_08280) | - | 1697064..1697522 (-) | 459 | WP_262582890.1 | hypothetical protein | - |
| MUA82_RS08290 (MUA82_08285) | - | 1697535..1697783 (-) | 249 | WP_070848526.1 | helix-turn-helix transcriptional regulator | - |
| MUA82_RS08295 (MUA82_08290) | - | 1697977..1698615 (+) | 639 | WP_262582891.1 | S24 family peptidase | - |
| MUA82_RS08300 (MUA82_08295) | - | 1698634..1699113 (+) | 480 | WP_262582892.1 | hypothetical protein | - |
| MUA82_RS08305 (MUA82_08300) | - | 1699494..1700147 (+) | 654 | WP_262582893.1 | CPBP family intramembrane glutamic endopeptidase | - |
| MUA82_RS08310 (MUA82_08305) | - | 1700216..1701244 (+) | 1029 | WP_262582894.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16780.43 Da Isoelectric Point: 5.2477
>NTDB_id=670913 MUA82_RS08235 WP_262582885.1 1692707..1693153(-) (ssb) [Staphylococcus simulans strain IVB6174]
MLNRVVLVGRLTKDPEFRTTQSGVDVTTFTLAVNRNFKSKNGEQQADFINCVVFRKQAENVNNYLNKGSLAGIDGRLQSR
SYENKEGQRVFVTEVVCDSVQFLEPKNTQSSNNNQSNNQVQQREKALQSENSFNNSDNFDMDDSSLPF
MLNRVVLVGRLTKDPEFRTTQSGVDVTTFTLAVNRNFKSKNGEQQADFINCVVFRKQAENVNNYLNKGSLAGIDGRLQSR
SYENKEGQRVFVTEVVCDSVQFLEPKNTQSSNNNQSNNQVQQREKALQSENSFNNSDNFDMDDSSLPF
Nucleotide
Download Length: 447 bp
>NTDB_id=670913 MUA82_RS08235 WP_262582885.1 1692707..1693153(-) (ssb) [Staphylococcus simulans strain IVB6174]
ATGTTAAACAGAGTCGTATTAGTTGGAAGACTGACAAAAGACCCGGAATTCAGAACAACGCAAAGCGGTGTAGATGTGAC
AACATTCACACTAGCAGTCAATCGTAATTTTAAGAGTAAAAATGGAGAACAACAGGCAGACTTTATCAACTGTGTTGTAT
TCCGTAAACAAGCAGAAAACGTCAATAATTATTTGAATAAAGGCAGTTTAGCAGGTATCGATGGTCGCTTACAATCACGA
AGCTATGAGAATAAGGAAGGGCAAAGAGTCTTTGTTACGGAAGTCGTGTGTGACAGTGTGCAATTCCTAGAACCTAAGAA
TACACAATCTTCAAATAATAACCAATCAAATAACCAAGTGCAGCAAAGAGAGAAGGCGCTTCAAAGCGAAAATTCATTCA
ATAATAGCGACAACTTTGATATGGATGATTCATCTTTACCGTTTTGA
ATGTTAAACAGAGTCGTATTAGTTGGAAGACTGACAAAAGACCCGGAATTCAGAACAACGCAAAGCGGTGTAGATGTGAC
AACATTCACACTAGCAGTCAATCGTAATTTTAAGAGTAAAAATGGAGAACAACAGGCAGACTTTATCAACTGTGTTGTAT
TCCGTAAACAAGCAGAAAACGTCAATAATTATTTGAATAAAGGCAGTTTAGCAGGTATCGATGGTCGCTTACAATCACGA
AGCTATGAGAATAAGGAAGGGCAAAGAGTCTTTGTTACGGAAGTCGTGTGTGACAGTGTGCAATTCCTAGAACCTAAGAA
TACACAATCTTCAAATAATAACCAATCAAATAACCAAGTGCAGCAAAGAGAGAAGGCGCTTCAAAGCGAAAATTCATTCA
ATAATAGCGACAACTTTGATATGGATGATTCATCTTTACCGTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
48.824 |
100 |
0.561 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
73.832 |
72.297 |
0.534 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
71.622 |
0.412 |
| ssbA | Streptococcus mutans UA159 |
40.541 |
100 |
0.405 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
39.865 |
100 |
0.399 |