Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MUA31_RS09195 | Genome accession | NZ_CP094698 |
| Coordinates | 1922712..1923158 (-) | Length | 148 a.a. |
| NCBI ID | WP_262546318.1 | Uniprot ID | - |
| Organism | Staphylococcus simulans strain IVB6241 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1892133..1934867 | 1922712..1923158 | within | 0 |
Gene organization within MGE regions
Location: 1892133..1934867
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA31_RS08975 (MUA31_08975) | - | 1892133..1892636 (+) | 504 | WP_023015780.1 | hypothetical protein | - |
| MUA31_RS08980 (MUA31_08980) | - | 1893587..1895032 (-) | 1446 | WP_262546258.1 | SH3 domain-containing protein | - |
| MUA31_RS08985 (MUA31_08985) | - | 1895013..1895435 (-) | 423 | WP_262546259.1 | phage holin | - |
| MUA31_RS08990 (MUA31_08990) | - | 1895478..1895873 (-) | 396 | WP_107534072.1 | hypothetical protein | - |
| MUA31_RS08995 (MUA31_08995) | - | 1895857..1896279 (-) | 423 | WP_107538240.1 | hypothetical protein | - |
| MUA31_RS09000 (MUA31_09000) | - | 1896316..1896594 (-) | 279 | WP_262546261.1 | hypothetical protein | - |
| MUA31_RS09005 (MUA31_09005) | - | 1896606..1898492 (-) | 1887 | WP_262546262.1 | phage tail protein | - |
| MUA31_RS09010 (MUA31_09010) | - | 1898505..1899737 (-) | 1233 | WP_262546263.1 | hypothetical protein | - |
| MUA31_RS09015 (MUA31_09015) | - | 1899734..1900855 (-) | 1122 | WP_262546266.1 | hypothetical protein | - |
| MUA31_RS09020 (MUA31_09020) | - | 1900869..1901795 (-) | 927 | WP_262546268.1 | phage tail family protein | - |
| MUA31_RS09025 (MUA31_09025) | - | 1901799..1905002 (-) | 3204 | WP_262546270.1 | phage tail protein | - |
| MUA31_RS09030 (MUA31_09030) | - | 1905025..1905312 (-) | 288 | WP_262546271.1 | hypothetical protein | - |
| MUA31_RS09035 (MUA31_09035) | - | 1905372..1905830 (-) | 459 | WP_105976105.1 | tail assembly chaperone | - |
| MUA31_RS09040 (MUA31_09040) | - | 1905899..1906456 (-) | 558 | WP_262546272.1 | phage tail protein | - |
| MUA31_RS09045 (MUA31_09045) | - | 1906470..1906940 (-) | 471 | WP_262546273.1 | hypothetical protein | - |
| MUA31_RS09050 (MUA31_09050) | - | 1906955..1907335 (-) | 381 | WP_262546274.1 | HK97 gp10 family phage protein | - |
| MUA31_RS09055 (MUA31_09055) | - | 1907339..1907662 (-) | 324 | WP_262546275.1 | head-tail adaptor protein | - |
| MUA31_RS09060 (MUA31_09060) | - | 1907652..1907972 (-) | 321 | WP_262546276.1 | phage head-tail connector protein | - |
| MUA31_RS09065 (MUA31_09065) | - | 1907984..1908151 (-) | 168 | WP_182671258.1 | hypothetical protein | - |
| MUA31_RS09070 (MUA31_09070) | - | 1908169..1909137 (-) | 969 | WP_262546277.1 | hypothetical protein | - |
| MUA31_RS09075 (MUA31_09075) | - | 1909152..1909721 (-) | 570 | WP_262546278.1 | phage scaffolding protein | - |
| MUA31_RS09080 (MUA31_09080) | - | 1909825..1910802 (-) | 978 | WP_262546279.1 | phage head morphogenesis protein | - |
| MUA31_RS09085 (MUA31_09085) | - | 1910780..1912117 (-) | 1338 | WP_262546280.1 | phage portal protein | - |
| MUA31_RS09090 (MUA31_09090) | - | 1912177..1913448 (-) | 1272 | WP_262546281.1 | PBSX family phage terminase large subunit | - |
| MUA31_RS09095 (MUA31_09095) | - | 1913448..1913825 (-) | 378 | WP_002480794.1 | hypothetical protein | - |
| MUA31_RS09100 (MUA31_09100) | - | 1913906..1914142 (-) | 237 | WP_262546282.1 | hypothetical protein | - |
| MUA31_RS09105 (MUA31_09105) | - | 1914361..1914765 (-) | 405 | WP_023015294.1 | sigma-70 family RNA polymerase sigma factor | - |
| MUA31_RS09110 (MUA31_09110) | rinB | 1915184..1915360 (-) | 177 | WP_262546283.1 | transcriptional activator RinB | - |
| MUA31_RS09115 (MUA31_09115) | - | 1915366..1915554 (-) | 189 | WP_262546284.1 | hypothetical protein | - |
| MUA31_RS09120 (MUA31_09120) | - | 1915609..1915989 (-) | 381 | WP_262546286.1 | hypothetical protein | - |
| MUA31_RS09125 (MUA31_09125) | - | 1916002..1916175 (-) | 174 | WP_262546289.1 | hypothetical protein | - |
| MUA31_RS09130 (MUA31_09130) | dut | 1916212..1916634 (-) | 423 | WP_262547453.1 | dUTP diphosphatase | - |
| MUA31_RS09135 (MUA31_09135) | - | 1916859..1917104 (-) | 246 | WP_156666639.1 | hypothetical protein | - |
| MUA31_RS09140 (MUA31_09140) | - | 1917118..1917381 (-) | 264 | WP_262546292.1 | hypothetical protein | - |
| MUA31_RS09145 (MUA31_09145) | - | 1917529..1917705 (-) | 177 | WP_262546295.1 | hypothetical protein | - |
| MUA31_RS09150 (MUA31_09150) | - | 1917706..1918137 (-) | 432 | WP_262546297.1 | DUF3310 domain-containing protein | - |
| MUA31_RS09155 (MUA31_09155) | - | 1918138..1918662 (-) | 525 | WP_262546300.1 | SA1788 family PVL leukocidin-associated protein | - |
| MUA31_RS09160 (MUA31_09160) | - | 1918665..1918850 (-) | 186 | WP_262546302.1 | hypothetical protein | - |
| MUA31_RS09165 (MUA31_09165) | - | 1918851..1919258 (-) | 408 | WP_262546305.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MUA31_RS09170 (MUA31_09170) | - | 1919424..1920197 (-) | 774 | WP_262546308.1 | ATP-binding protein | - |
| MUA31_RS09175 (MUA31_09175) | - | 1920210..1920932 (-) | 723 | WP_262546311.1 | conserved phage C-terminal domain-containing protein | - |
| MUA31_RS09180 (MUA31_09180) | - | 1920978..1921460 (+) | 483 | WP_106421050.1 | hypothetical protein | - |
| MUA31_RS09185 (MUA31_09185) | - | 1921476..1922147 (-) | 672 | WP_262546313.1 | putative HNHc nuclease | - |
| MUA31_RS09190 (MUA31_09190) | - | 1922148..1922699 (-) | 552 | WP_262546315.1 | NUMOD4 motif-containing HNH endonuclease | - |
| MUA31_RS09195 (MUA31_09195) | ssbA | 1922712..1923158 (-) | 447 | WP_262546318.1 | single-stranded DNA-binding protein | Machinery gene |
| MUA31_RS09200 (MUA31_09200) | - | 1923158..1923829 (-) | 672 | WP_262546321.1 | ERF family protein | - |
| MUA31_RS09205 (MUA31_09205) | - | 1923829..1924311 (-) | 483 | WP_262546323.1 | siphovirus Gp157 family protein | - |
| MUA31_RS09210 (MUA31_09210) | - | 1924311..1924538 (-) | 228 | WP_070867200.1 | hypothetical protein | - |
| MUA31_RS09215 (MUA31_09215) | - | 1924628..1924831 (-) | 204 | WP_262546327.1 | helix-turn-helix transcriptional regulator | - |
| MUA31_RS09220 (MUA31_09220) | - | 1924843..1925058 (-) | 216 | WP_262546331.1 | hypothetical protein | - |
| MUA31_RS09225 (MUA31_09225) | - | 1925064..1925276 (-) | 213 | WP_262546334.1 | hypothetical protein | - |
| MUA31_RS09230 (MUA31_09230) | - | 1925290..1925661 (-) | 372 | WP_262546337.1 | hypothetical protein | - |
| MUA31_RS09235 (MUA31_09235) | - | 1925675..1925941 (-) | 267 | WP_262546340.1 | hypothetical protein | - |
| MUA31_RS09240 (MUA31_09240) | - | 1926000..1926674 (+) | 675 | WP_107529553.1 | hypothetical protein | - |
| MUA31_RS09245 (MUA31_09245) | - | 1926677..1926874 (-) | 198 | WP_262546343.1 | hypothetical protein | - |
| MUA31_RS09250 (MUA31_09250) | - | 1926888..1927136 (-) | 249 | WP_070848526.1 | helix-turn-helix transcriptional regulator | - |
| MUA31_RS09255 (MUA31_09255) | - | 1927331..1927969 (+) | 639 | WP_262546346.1 | S24 family peptidase | - |
| MUA31_RS09260 (MUA31_09260) | - | 1927985..1928554 (+) | 570 | WP_262546349.1 | DUF5067 domain-containing protein | - |
| MUA31_RS09265 (MUA31_09265) | - | 1928782..1929360 (-) | 579 | WP_262546351.1 | hypothetical protein | - |
| MUA31_RS09270 (MUA31_09270) | - | 1929511..1930341 (+) | 831 | WP_262546355.1 | KilA-N domain-containing protein | - |
| MUA31_RS09275 (MUA31_09275) | - | 1930406..1931449 (+) | 1044 | WP_262546357.1 | site-specific integrase | - |
| MUA31_RS09285 (MUA31_09285) | - | 1931890..1932024 (+) | 135 | WP_002480580.1 | beta-class phenol-soluble modulin | - |
| MUA31_RS09290 (MUA31_09290) | - | 1932191..1932853 (+) | 663 | WP_262546360.1 | 3'-5' exonuclease | - |
| MUA31_RS09295 (MUA31_09295) | - | 1932869..1933267 (+) | 399 | WP_070626672.1 | YkvA family protein | - |
| MUA31_RS09300 (MUA31_09300) | - | 1933353..1933796 (-) | 444 | WP_262546363.1 | VOC family protein | - |
| MUA31_RS09305 (MUA31_09305) | - | 1933916..1934290 (+) | 375 | WP_262546366.1 | VOC family protein | - |
| MUA31_RS09310 (MUA31_09310) | - | 1934358..1934867 (-) | 510 | WP_002480575.1 | YfcE family phosphodiesterase | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16673.37 Da Isoelectric Point: 5.2477
>NTDB_id=670768 MUA31_RS09195 WP_262546318.1 1922712..1923158(-) (ssbA) [Staphylococcus simulans strain IVB6241]
MLNRVVLVGRLTKDPEFRTTQSGVDVATFTLAVNRNFKSKNGEQQADFINCVVFRKQAENVNNYLNKGSLAGIDGRLQSR
SYENKEGQRVFVTEVVCDSVQFLEPKNAQASNSNQSNNEVQQREKALQSDNPFNNSNNFDMDDSSLPF
MLNRVVLVGRLTKDPEFRTTQSGVDVATFTLAVNRNFKSKNGEQQADFINCVVFRKQAENVNNYLNKGSLAGIDGRLQSR
SYENKEGQRVFVTEVVCDSVQFLEPKNAQASNSNQSNNEVQQREKALQSDNPFNNSNNFDMDDSSLPF
Nucleotide
Download Length: 447 bp
>NTDB_id=670768 MUA31_RS09195 WP_262546318.1 1922712..1923158(-) (ssbA) [Staphylococcus simulans strain IVB6241]
ATGTTAAACAGAGTCGTATTAGTAGGTCGCTTAACAAAAGACCCAGAATTCAGAACAACGCAAAGCGGTGTAGATGTAGC
AACATTCACACTAGCGGTCAACCGTAATTTTAAGAGTAAAAACGGAGAGCAACAGGCGGACTTTATCAACTGTGTTGTAT
TCCGTAAACAAGCAGAAAACGTCAATAATTATTTGAATAAAGGCAGTTTAGCAGGTATCGATGGTCGCTTACAATCACGA
AGCTATGAGAATAAGGAAGGGCAAAGAGTGTTTGTTACGGAAGTCGTATGTGACAGTGTGCAATTCCTAGAACCTAAGAA
TGCACAAGCCTCAAACAGTAACCAATCAAATAACGAAGTGCAGCAAAGAGAGAAGGCGCTTCAAAGCGACAATCCATTCA
ATAATAGCAACAACTTTGATATGGATGATTCATCTTTACCGTTTTGA
ATGTTAAACAGAGTCGTATTAGTAGGTCGCTTAACAAAAGACCCAGAATTCAGAACAACGCAAAGCGGTGTAGATGTAGC
AACATTCACACTAGCGGTCAACCGTAATTTTAAGAGTAAAAACGGAGAGCAACAGGCGGACTTTATCAACTGTGTTGTAT
TCCGTAAACAAGCAGAAAACGTCAATAATTATTTGAATAAAGGCAGTTTAGCAGGTATCGATGGTCGCTTACAATCACGA
AGCTATGAGAATAAGGAAGGGCAAAGAGTGTTTGTTACGGAAGTCGTATGTGACAGTGTGCAATTCCTAGAACCTAAGAA
TGCACAAGCCTCAAACAGTAACCAATCAAATAACGAAGTGCAGCAAAGAGAGAAGGCGCTTCAAAGCGACAATCCATTCA
ATAATAGCAACAACTTTGATATGGATGATTCATCTTTACCGTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.977 |
100 |
0.662 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.574 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
71.622 |
0.419 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
39.189 |
100 |
0.392 |
| ssbA | Streptococcus mutans UA159 |
46.667 |
81.081 |
0.378 |