Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG16_RS00730 Genome accession   NZ_CP094143
Coordinates   158228..158353 (+) Length   41 a.a.
NCBI ID   WP_075668089.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe032     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 153228..163353
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG16_RS00705 (MPG16_00705) - 153290..155512 (+) 2223 WP_245108596.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG16_RS00710 (MPG16_00710) panD 155502..155852 (+) 351 WP_245108597.1 aspartate 1-decarboxylase -
  MPG16_RS00715 (MPG16_00715) - 155863..156156 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  MPG16_RS00720 (MPG16_00720) - 156156..157151 (+) 996 WP_245108911.1 PDZ domain-containing protein -
  MPG16_RS00725 (MPG16_00725) comB6 157157..158212 (+) 1056 WP_245108912.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG16_RS00730 (MPG16_00730) comB7 158228..158353 (+) 126 WP_075668089.1 comB7 lipoprotein Machinery gene
  MPG16_RS00735 (MPG16_00735) comB8 158350..159093 (+) 744 WP_015429416.1 virB8 family protein Machinery gene
  MPG16_RS00740 (MPG16_00740) comB9 159093..160055 (+) 963 WP_245108598.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG16_RS00745 (MPG16_00745) comB10 160048..161184 (+) 1137 WP_245108599.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG16_RS00750 (MPG16_00750) - 161254..162669 (+) 1416 WP_245108600.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4738.72 Da        Isoelectric Point: 9.3278

>NTDB_id=667528 MPG16_RS00730 WP_075668089.1 158228..158353(+) (comB7) [Helicobacter pylori strain Hpfe032]
MRIFSVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667528 MPG16_RS00730 WP_075668089.1 158228..158353(+) (comB7) [Helicobacter pylori strain Hpfe032]
ATGAGAATTTTTTCTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854


Multiple sequence alignment