Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPF96_RS00710 Genome accession   NZ_CP094101
Coordinates   149539..149652 (+) Length   37 a.a.
NCBI ID   WP_073422943.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe079     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 144539..154652
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPF96_RS00685 (MPF96_00685) - 144599..146821 (+) 2223 WP_245049200.1 ATP-dependent Clp protease ATP-binding subunit -
  MPF96_RS00690 (MPF96_00690) panD 146811..147161 (+) 351 WP_154548548.1 aspartate 1-decarboxylase -
  MPF96_RS00695 (MPF96_00695) - 147172..147465 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  MPF96_RS00700 (MPF96_00700) - 147465..148460 (+) 996 WP_245049851.1 PDZ domain-containing protein -
  MPF96_RS00705 (MPF96_00705) comB6 148468..149523 (+) 1056 WP_245049853.1 P-type conjugative transfer protein TrbL Machinery gene
  MPF96_RS00710 (MPF96_00710) comB7 149539..149652 (+) 114 WP_073422943.1 comB7 lipoprotein Machinery gene
  MPF96_RS00715 (MPF96_00715) comB8 149649..150392 (+) 744 WP_000660545.1 virB8 family protein Machinery gene
  MPF96_RS00720 (MPF96_00720) comB9 150392..151357 (+) 966 WP_245049203.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPF96_RS00725 (MPF96_00725) comB10 151350..152486 (+) 1137 WP_245049205.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPF96_RS00730 (MPF96_00730) - 152557..153969 (+) 1413 WP_245049207.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4287.23 Da        Isoelectric Point: 9.3572

>NTDB_id=666852 MPF96_RS00710 WP_073422943.1 149539..149652(+) (comB7) [Helicobacter pylori strain Hpfe079]
MRIFFVIIGLILFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=666852 MPF96_RS00710 WP_073422943.1 149539..149652(+) (comB7) [Helicobacter pylori strain Hpfe079]
ATGAGAATTTTTTTTGTTATTATTGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAATAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919