Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG11_RS00730 Genome accession   NZ_CP094067
Coordinates   149853..149978 (+) Length   41 a.a.
NCBI ID   WP_001217867.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe108     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 144853..154978
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG11_RS00705 (MPG11_00705) - 144913..147135 (+) 2223 WP_245052683.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG11_RS00710 (MPG11_00710) panD 147125..147475 (+) 351 WP_000142212.1 aspartate 1-decarboxylase -
  MPG11_RS00715 (MPG11_00715) - 147486..147779 (+) 294 WP_050835701.1 YbaB/EbfC family nucleoid-associated protein -
  MPG11_RS00720 (MPG11_00720) - 147779..148774 (+) 996 WP_245049992.1 PDZ domain-containing protein -
  MPG11_RS00725 (MPG11_00725) comB6 148782..149837 (+) 1056 WP_245049440.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG11_RS00730 (MPG11_00730) comB7 149853..149978 (+) 126 WP_001217867.1 hypothetical protein Machinery gene
  MPG11_RS00735 (MPG11_00735) comB8 149975..150718 (+) 744 WP_060760673.1 virB8 family protein Machinery gene
  MPG11_RS00740 (MPG11_00740) comB9 150718..151683 (+) 966 WP_245052685.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG11_RS00745 (MPG11_00745) comB10 151676..152812 (+) 1137 WP_245052687.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG11_RS00750 (MPG11_00750) - 152882..154294 (+) 1413 WP_245052689.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4830.88 Da        Isoelectric Point: 9.3278

>NTDB_id=666371 MPG11_RS00730 WP_001217867.1 149853..149978(+) (comB7) [Helicobacter pylori strain Hpfe108]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=666371 MPG11_RS00730 WP_001217867.1 149853..149978(+) (comB7) [Helicobacter pylori strain Hpfe108]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAAATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829