Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPF87_RS00790 Genome accession   NZ_CP094052
Coordinates   167411..167536 (+) Length   41 a.a.
NCBI ID   WP_001217865.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe126     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 162411..172536
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPF87_RS00765 (MPF87_00765) - 162476..164698 (+) 2223 WP_245012726.1 ATP-dependent Clp protease ATP-binding subunit -
  MPF87_RS00770 (MPF87_00770) panD 164688..165041 (+) 354 WP_245012727.1 aspartate 1-decarboxylase -
  MPF87_RS00775 (MPF87_00775) - 165044..165337 (+) 294 WP_048944407.1 YbaB/EbfC family nucleoid-associated protein -
  MPF87_RS00780 (MPF87_00780) - 165337..166332 (+) 996 WP_245013052.1 PDZ domain-containing protein -
  MPF87_RS00785 (MPF87_00785) comB6 166340..167395 (+) 1056 WP_245013053.1 P-type conjugative transfer protein TrbL Machinery gene
  MPF87_RS00790 (MPF87_00790) comB7 167411..167536 (+) 126 WP_001217865.1 hypothetical protein Machinery gene
  MPF87_RS00795 (MPF87_00795) comB8 167533..168276 (+) 744 WP_000660533.1 virB8 family protein Machinery gene
  MPF87_RS00800 (MPF87_00800) comB9 168276..169241 (+) 966 WP_245012728.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPF87_RS00805 (MPF87_00805) comB10 169234..170370 (+) 1137 WP_245012729.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPF87_RS00810 (MPF87_00810) - 170440..171852 (+) 1413 WP_245012730.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4794.82 Da        Isoelectric Point: 9.3278

>NTDB_id=666132 MPF87_RS00790 WP_001217865.1 167411..167536(+) (comB7) [Helicobacter pylori strain Hpfe126]
MRIFFVIIGLILFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=666132 MPF87_RS00790 WP_001217865.1 167411..167536(+) (comB7) [Helicobacter pylori strain Hpfe126]
ATGAGAATTTTTTTTGTTATTATTGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829