NTDB

Overview

Name	comM	Type	Machinery gene
Locus tag	MQG43_RS01500	Genome accession	NZ_CP093910
Coordinates	295748..296452 (+)	Length	234 a.a.
NCBI ID	WP_309137068.1	Uniprot ID	-
Organism	Aggregatibacter actinomycetemcomitans strain 27R
Function	require for natural transformation (predicted from homology) Unclear

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
ICE	293038..315003	295748..296452	within	0

Gene organization within MGE regions

Location: 293038..315003

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MQG43_RS01490	-	293038..294957 (-)	1920	WP_005559215.1	Mu transposase C-terminal domain-containing protein	-
MQG43_RS01495	-	294950..295612 (-)	663	WP_005548207.1	heteromeric transposase endonuclease subunit TnsA	-
MQG43_RS01500	comM	295748..296452 (+)	705	WP_309137068.1	ATP-binding protein	Machinery gene
MQG43_RS01505	-	296464..297282 (-)	819	WP_005548203.1	divergent polysaccharide deacetylase family protein	-
MQG43_RS01510	envC	297288..298547 (-)	1260	WP_032999579.1	murein hydrolase activator EnvC	-
MQG43_RS01515	-	298756..300414 (-)	1659	WP_005548199.1	phospho-sugar mutase	-
MQG43_RS01520	-	300720..301403 (+)	684	WP_005548197.1	2,3-diphosphoglycerate-dependent phosphoglycerate mutase	-
MQG43_RS01525	-	301488..301982 (-)	495	WP_005548195.1	YfbU family protein	-
MQG43_RS01530	-	302000..302743 (-)	744	WP_032996149.1	VacJ family lipoprotein	-
MQG43_RS01535	nikA	302842..304425 (-)	1584	WP_258271245.1	nickel ABC transporter substrate-binding protein	-
MQG43_RS01540	hslU	304491..305822 (-)	1332	WP_005538655.1	HslU--HslV peptidase ATPase subunit	-
MQG43_RS01545	hslV	305843..306370 (-)	528	WP_005548189.1	ATP-dependent protease subunit HslV	-
MQG43_RS01550	aphA	306585..307292 (+)	708	WP_005548187.1	acid phosphatase AphA	-
MQG43_RS01555	-	307674..307991 (-)	318	Protein_302	DUF4298 domain-containing protein	-
MQG43_RS01560	mtr	308270..309514 (-)	1245	WP_258271246.1	tryptophan permease	-
MQG43_RS01565	ppa	309676..310203 (+)	528	WP_005548178.1	inorganic diphosphatase	-
MQG43_RS01570	-	310279..311052 (+)	774	WP_005548176.1	M48 family metallopeptidase	-
MQG43_RS01575	ribB	311732..312376 (+)	645	WP_005548174.1	3,4-dihydroxy-2-butanone-4-phosphate synthase	-
MQG43_RS01580	trpS	312463..313467 (-)	1005	WP_005575514.1	tryptophan--tRNA ligase	-
MQG43_RS01585	ftsY	313642..315003 (-)	1362	WP_005548170.1	signal recognition particle-docking protein FtsY	-

Sequence

Protein

Download Length: 234 a.a. Molecular weight: 26218.05 Da Isoelectric Point: 9.8867

                                >NTDB_id=665386 MQG43_RS01500 WP_309137068.1 295748..296452(+) (comM) [Aggregatibacter actinomycetemcomitans strain 27R]

MPLICNFDSGTIPKPGEISLAHNGVFFLDELPEFERKVLDALRQPLESGEIIISRANAKIQFPAKFQLIAAMNPSPTGHY

QGTHNRTSPQQVMRYLNRLSGPFLDRFDLSIEVPLLPQGSLQNSGDRGESSATVREKVLKTRAIQLQRAGKINAHLNSKE

IERDCKLTDKDAQFLENALTKLGLSVRAYHRILKVSRTIADLDGEQHINQRHLAEALGYRAMDRLLQKLAKNSA

Nucleotide

Download Length: 705 bp

                                >NTDB_id=665386 MQG43_RS01500 WP_309137068.1 295748..296452(+) (comM) [Aggregatibacter actinomycetemcomitans strain 27R]

ATGCCACTTATTTGTAACTTTGACAGCGGCACGATCCCCAAACCGGGCGAAATTTCCCTCGCTCACAATGGCGTGTTTTT

CTTAGATGAGTTGCCCGAATTTGAACGCAAAGTGCTGGACGCGCTGCGTCAACCATTGGAAAGTGGCGAAATTATTATTT

CCCGCGCCAACGCCAAGATTCAATTTCCGGCAAAATTTCAACTGATTGCCGCGATGAATCCCAGCCCGACAGGGCATTAT

CAAGGCACGCATAATCGCACCTCACCACAACAAGTTATGCGTTATCTGAATCGGTTATCCGGCCCTTTTTTAGATCGCTT

CGATTTATCCATTGAAGTGCCCTTATTACCACAAGGCAGCTTACAAAATAGCGGCGATCGTGGCGAATCCAGCGCAACGG

TGCGAGAAAAAGTCCTGAAAACCCGTGCCATTCAACTTCAGCGCGCCGGCAAAATTAATGCCCATTTAAATAGCAAAGAA

ATCGAACGGGACTGCAAACTAACCGACAAAGACGCACAGTTCCTGGAAAATGCCCTGACTAAACTGGGGCTTTCCGTACG

AGCGTACCACCGCATACTGAAAGTGTCCCGCACCATTGCCGATTTAGATGGAGAACAACACATCAACCAGCGCCATCTGG

CCGAAGCTCTGGGTTATCGGGCAATGGACAGGTTGTTGCAAAAATTGGCGAAAAACTCGGCGTAA

Domains

Predicted by InterproScan.

Magnesium chelatase, subunit ChlI (Mg_chelatase)

(9-118)

Magnesium chelatase, subunit ChlI C-terminal (Mg_chelatase_C)

(128-220)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comM	Haemophilus influenzae Rd KW20	86.522	98.291	0.85
comM	Glaesserella parasuis strain SC1401	80.603	99.145	0.799
comM	Vibrio cholerae strain A1552	67.421	94.444	0.637
comM	Vibrio campbellii strain DS40M4	65.455	94.017	0.615
RA0C_RS07335	Riemerella anatipestifer ATCC 11845 = DSM 15868	51.556	96.154	0.496
comM	Legionella pneumophila str. Paris	51.402	91.453	0.47
comM	Legionella pneumophila strain ERS1305867	51.402	91.453	0.47

Detailed information NTG0665386