Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   MM522_RS09930 Genome accession   NZ_CP093067
Coordinates   1956077..1956460 (-) Length   127 a.a.
NCBI ID   WP_015251713.1    Uniprot ID   -
Organism   Bacillus subtilis strain ATC-3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1951077..1961460
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MM522_RS09890 (MM522_09890) sinI 1952011..1952184 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MM522_RS09895 (MM522_09895) sinR 1952218..1952553 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MM522_RS09900 (MM522_09900) tasA 1952646..1953431 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  MM522_RS09905 (MM522_09905) sipW 1953495..1954067 (-) 573 WP_003246088.1 signal peptidase I -
  MM522_RS09910 (MM522_09910) tapA 1954051..1954812 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  MM522_RS09915 (MM522_09915) yqzG 1955084..1955410 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MM522_RS09920 (MM522_09920) spoIIT 1955452..1955631 (-) 180 WP_003230176.1 YqzE family protein -
  MM522_RS09925 (MM522_09925) comGG 1955702..1956076 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  MM522_RS09930 (MM522_09930) comGF 1956077..1956460 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  MM522_RS09935 (MM522_09935) comGE 1956486..1956833 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  MM522_RS09940 (MM522_09940) comGD 1956817..1957248 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  MM522_RS09945 (MM522_09945) comGC 1957238..1957534 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  MM522_RS09950 (MM522_09950) comGB 1957548..1958585 (-) 1038 WP_101172386.1 comG operon protein ComGB Machinery gene
  MM522_RS09955 (MM522_09955) comGA 1958572..1959642 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  MM522_RS09960 (MM522_09960) - 1959855..1960052 (-) 198 WP_029726717.1 hypothetical protein -
  MM522_RS09965 (MM522_09965) corA 1960054..1961007 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14280.43 Da        Isoelectric Point: 6.4838

>NTDB_id=661843 MM522_RS09930 WP_015251713.1 1956077..1956460(-) (comGF) [Bacillus subtilis strain ATC-3]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=661843 MM522_RS09930 WP_015251713.1 1956077..1956460(-) (comGF) [Bacillus subtilis strain ATC-3]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992