Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MM522_RS09890 Genome accession   NZ_CP093067
Coordinates   1952011..1952184 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain ATC-3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1947011..1957184
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MM522_RS09875 (MM522_09875) gcvT 1947810..1948898 (-) 1089 WP_015251720.1 glycine cleavage system aminomethyltransferase GcvT -
  MM522_RS09880 (MM522_09880) yqhH 1949340..1951013 (+) 1674 WP_004398544.1 SNF2-related protein -
  MM522_RS09885 (MM522_09885) yqhG 1951034..1951828 (+) 795 WP_003230200.1 YqhG family protein -
  MM522_RS09890 (MM522_09890) sinI 1952011..1952184 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MM522_RS09895 (MM522_09895) sinR 1952218..1952553 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MM522_RS09900 (MM522_09900) tasA 1952646..1953431 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  MM522_RS09905 (MM522_09905) sipW 1953495..1954067 (-) 573 WP_003246088.1 signal peptidase I -
  MM522_RS09910 (MM522_09910) tapA 1954051..1954812 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  MM522_RS09915 (MM522_09915) yqzG 1955084..1955410 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MM522_RS09920 (MM522_09920) spoIIT 1955452..1955631 (-) 180 WP_003230176.1 YqzE family protein -
  MM522_RS09925 (MM522_09925) comGG 1955702..1956076 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  MM522_RS09930 (MM522_09930) comGF 1956077..1956460 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  MM522_RS09935 (MM522_09935) comGE 1956486..1956833 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=661840 MM522_RS09890 WP_003230187.1 1952011..1952184(+) (sinI) [Bacillus subtilis strain ATC-3]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=661840 MM522_RS09890 WP_003230187.1 1952011..1952184(+) (sinI) [Bacillus subtilis strain ATC-3]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1